Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Adhesion G-protein coupled receptor D1

Gene

ADGRD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Orphan receptor. Signals via G(s)-alpha family of G-proteins (PubMed:22025619, PubMed:22575658). Has protumorigenic function especially in glioblastoma (PubMed:27775701).3 Publications

GO - Molecular functioni

  • G-protein coupled receptor activity Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

Protein family/group databases

MEROPSiP02.021.

Names & Taxonomyi

Protein namesi
Recommended name:
Adhesion G-protein coupled receptor D11 Publication
Alternative name(s):
G-protein coupled receptor 133
G-protein coupled receptor PGR25
Gene namesi
Name:ADGRD1
Synonyms:GPR133, PGR25
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:19893. ADGRD1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini26 – 570ExtracellularCuratedAdd BLAST545
Transmembranei571 – 591Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini592 – 602CytoplasmicCuratedAdd BLAST11
Transmembranei603 – 623Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini624 – 633ExtracellularCurated10
Transmembranei634 – 654Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini655 – 674CytoplasmicCuratedAdd BLAST20
Transmembranei675 – 695Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini696 – 711ExtracellularCuratedAdd BLAST16
Transmembranei712 – 732Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini733 – 760CytoplasmicCuratedAdd BLAST28
Transmembranei761 – 781Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini782 – 784ExtracellularCurated3
Transmembranei785 – 805Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini806 – 874CytoplasmicCuratedAdd BLAST69

GO - Cellular componenti

  • integral component of membrane Source: GDB
  • plasma membrane Source: UniProtKB

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi543H → R: Does not affect membrane trafficking and basal activity. 1 Publication1
Mutagenesisi545T → A: No effect on G-protein coupled receptor activity; does not affect subcellular location. 1 Publication1
Mutagenesisi550L → A: Abolishes G-protein coupled receptor activity; does not affect subcellular location. 1 Publication1
Mutagenesisi551M → A: Abolishes G-protein coupled receptor activity; does not affect subcellular location. 1 Publication1
Mutagenesisi554V → A: Abolishes G-protein coupled receptor activity; does not affect subcellular location. 1 Publication1
Mutagenesisi808L → T: Does not affect membrane trafficking. Abolishes receptor activity. 1 Publication1

Organism-specific databases

DisGeNETi283383.
OpenTargetsiENSG00000111452.
PharmGKBiPA134923933.

Polymorphism and mutation databases

BioMutaiGPR133.
DMDMi59797935.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 25Sequence analysisAdd BLAST25
ChainiPRO_000001290526 – 874Adhesion G-protein coupled receptor D1Add BLAST849

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi90N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi185N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi282N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi302N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi319N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi394N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi476N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi501N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi533N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ6QNK2.
PeptideAtlasiQ6QNK2.
PRIDEiQ6QNK2.

PTM databases

iPTMnetiQ6QNK2.
PhosphoSitePlusiQ6QNK2.

Expressioni

Tissue specificityi

Up-regulated in CD133+ cell population of glioblastoma.1 Publication

Inductioni

Up-regulated by hypoxia in hypoxia-inducible factor 1-alpha (HIF1A)-dependent manner.1 Publication

Gene expression databases

BgeeiENSG00000111452.
CleanExiHS_GPR133.
ExpressionAtlasiQ6QNK2. baseline and differential.
GenevisibleiQ6QNK2. HS.

Organism-specific databases

HPAiHPA042395.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000261654.

Structurei

3D structure databases

ProteinModelPortaliQ6QNK2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini79 – 276Pentraxin (PTX)PROSITE-ProRule annotationAdd BLAST198
Domaini507 – 556GPSPROSITE-ProRule annotationAdd BLAST50

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi546 – 554Stachel1 Publication9

Domaini

A short peptide sequence (termed the Stachel sequence) in the C-terminal part of the extracellular domain (ECD) functions as a tethered agonist. Upon structural changes within the ECD, e.g. due to extracellular ligand binding or mechanical movements, this intramolecular agonist is exposed to the 7 transmembrane region, triggering G-protein activation.1 Publication
The N-terminal domain and autocatalytic activity of ADGRD1 at the GPCR proteolysis site (GPS) are not required for G-protein coupling activity.1 Publication

Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4193. Eukaryota.
ENOG410XSD2. LUCA.
GeneTreeiENSGT00830000128227.
HOGENOMiHOG000056451.
HOVERGENiHBG051779.
InParanoidiQ6QNK2.
KOiK08465.
OrthoDBiEOG091G00GJ.
PhylomeDBiQ6QNK2.
TreeFamiTF351999.

Family and domain databases

InterProiView protein in InterPro
IPR013320. ConA-like_dom.
IPR017981. GPCR_2-like.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
PfamiView protein in Pfam
PF00002. 7tm_2. 1 hit.
PF01825. GPS. 1 hit.
PRINTSiPR00249. GPCRSECRETIN.
SMARTiView protein in SMART
SM00303. GPS. 1 hit.
SUPFAMiSSF49899. SSF49899. 1 hit.
PROSITEiView protein in PROSITE
PS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
PS51828. PTX_2. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6QNK2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEKLLRLCCW YSWLLLFYYN FQVRGVYSRS QDHPGFQVLA SASHYWPLEN
60 70 80 90 100
VDGIHELQDT TGDIVEGKVN KGIYLKEEKG VTLLYYGRYN SSCISKPEQC
110 120 130 140 150
GPEGVTFSFF WKTQGEQSRP IPSAYGGQVI SNGFKVCSSG GRGSVELYTR
160 170 180 190 200
DNSMTWEASF SPPGPYWTHV LFTWKSKEGL KVYVNGTLST SDPSGKVSRD
210 220 230 240 250
YGESNVNLVI GSEQDQAKCY ENGAFDEFII WERALTPDEI AMYFTAAIGK
260 270 280 290 300
HALLSSTLPS LFMTSTASPV MPTDAYHPII TNLTEERKTF QSPGVILSYL
310 320 330 340 350
QNVSLSLPSK SLSEQTALNL TKTFLKAVGE ILLLPGWIAL SEDSAVVLSL
360 370 380 390 400
IDTIDTVMGH VSSNLHGSTP QVTVEGSSAM AEFSVAKILP KTVNSSHYRF
410 420 430 440 450
PAHGQSFIQI PHEAFHRHAW STVVGLLYHS MHYYLNNIWP AHTKIAEAMH
460 470 480 490 500
HQDCLLFATS HLISLEVSPP PTLSQNLSGS PLITVHLKHR LTRKQHSEAT
510 520 530 540 550
NSSNRVFVYC AFLDFSSGEG VWSNHGCALT RGNLTYSVCR CTHLTNFAIL
560 570 580 590 600
MQVVPLELAR GHQVALSSIS YVGCSLSVLC LVATLVTFAV LSSVSTIRNQ
610 620 630 640 650
RYHIHANLSF AVLVAQVLLL ISFRLEPGTT PCQVMAVLLH YFFLSAFAWM
660 670 680 690 700
LVEGLHLYSM VIKVFGSEDS KHRYYYGMGW GFPLLICIIS LSFAMDSYGT
710 720 730 740 750
SNNCWLSLAS GAIWAFVAPA LFVIVVNIGI LIAVTRVISQ ISADNYKIHG
760 770 780 790 800
DPSAFKLTAK AVAVLLPILG TSWVFGVLAV NGCAVVFQYM FATLNSLQGL
810 820 830 840 850
FIFLFHCLLN SEVRAAFKHK TKVWSLTSSS ARTSNAKPFH SDLMNGTRPG
860 870
MASTKLSPWD KSSHSAHRVD LSAV
Length:874
Mass (Da):96,530
Last modified:July 5, 2004 - v1
Checksum:i8FC7C63D50F65E1B
GO
Isoform 2 (identifier: Q6QNK2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-314: Missing.
     315-341: QTALNLTKTFLKAVGEILLLPGWIALS → MEKGTELLVSPSQSGPGGDQPLLVKHR

Note: No experimental confirmation available.
Show »
Length:560
Mass (Da):61,360
Checksum:i3191A83261A5078D
GO
Isoform 3 (identifier: Q6QNK2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-481: Missing.
     482-491: LITVHLKHRL → MHRVCFLSFQ

Note: No experimental confirmation available.
Show »
Length:393
Mass (Da):43,210
Checksum:iD108A3060EA93E60
GO
Isoform 4 (identifier: Q6QNK2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     62-62: G → GASRTHKLTVLPSRNATFVYSNDSAYSNLSATV

Note: No experimental confirmation available.
Show »
Length:906
Mass (Da):99,984
Checksum:i1C8D7423F602F3E8
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti703N → S in AAP35063 (PubMed:15203201).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_07769818Y → C Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs149181066Ensembl.1
Natural variantiVAR_07769918Y → H Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs146611221Ensembl.1
Natural variantiVAR_07770032D → N Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs376178471Ensembl.1
Natural variantiVAR_07770178E → K Polymorphism; does not affect subcellular location; increases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs267603378Ensembl.1
Natural variantiVAR_07770282T → M Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs143395855Ensembl.1
Natural variantiVAR_07770385Y → C Polymorphism; does not affect subcellular location; decreases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs199848650Ensembl.1
Natural variantiVAR_07770489Y → D Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs201546462Ensembl.1
Natural variantiVAR_077705110F → L Polymorphism; reduces cell membrane location; decreases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs148928637Ensembl.1
Natural variantiVAR_077706138S → F Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs199526762Ensembl.1
Natural variantiVAR_077707140G → S Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs374985420Ensembl.1
Natural variantiVAR_077708141G → D Polymorphism; does not affect subcellular location; increases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs142759046Ensembl.1
Natural variantiVAR_077709145V → L Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs146945782Ensembl.1
Natural variantiVAR_077710150R → W Polymorphism; does not affect subcellular location; decreases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs144030317Ensembl.1
Natural variantiVAR_077711174W → S Polymorphism; reduces cell membrane location; decreases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs141606054Ensembl.1
Natural variantiVAR_077712178E → K Polymorphism; reduces cell membrane location; decreases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs148148477Ensembl.1
Natural variantiVAR_077713184V → I Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs61732860Ensembl.1
Natural variantiVAR_077714195G → R Polymorphism; reduces cell membrane location; decreases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs267603379Ensembl.1
Natural variantiVAR_077715199R → C Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs146310036Ensembl.1
Natural variantiVAR_077716199R → H Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs375084180Ensembl.1
Natural variantiVAR_077717203E → D Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs201045213Ensembl.1
Natural variantiVAR_077718209V → M Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs139478688Ensembl.1
Natural variantiVAR_077719226D → N Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs377562590Ensembl.1
Natural variantiVAR_077720233R → W Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs370807516Ensembl.1
Natural variantiVAR_077721241A → T Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs368468703Ensembl.1
Natural variantiVAR_077722242M → T Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs201057341Ensembl.1
Natural variantiVAR_077723245T → I Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs201053759Ensembl.1
Natural variantiVAR_077724257T → A Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs146563785Ensembl.1
Natural variantiVAR_077725259P → Q Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs75096240Ensembl.1
Natural variantiVAR_077726265S → Y Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs137909892Ensembl.1
Natural variantiVAR_077727268S → N Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs149012578Ensembl.1
Natural variantiVAR_077728270V → A Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs147773154Ensembl.1
Natural variantiVAR_077729270V → M Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs147773154Ensembl.1
Natural variantiVAR_077730293P → A Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs146929634Ensembl.1
Natural variantiVAR_077731294G → R Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs148017957Ensembl.1
Natural variantiVAR_077732308P → S Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs201661954Ensembl.1
Natural variantiVAR_077733318L → F Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs200641036Ensembl.1
Natural variantiVAR_077734349S → N Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs370854685Ensembl.1
Natural variantiVAR_077735364N → S Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs146050435Ensembl.1
Natural variantiVAR_077736369T → M Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs142314859Ensembl.1
Natural variantiVAR_077737383F → S Polymorphism; does not affect subcellular location; increases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs200232576Ensembl.1
Natural variantiVAR_077738393V → M Polymorphism; does not affect subcellular location; increases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs374606811Ensembl.1
Natural variantiVAR_077739397H → Q Polymorphism; does not affect subcellular location. 1 PublicationCorresponds to variant dbSNP:rs201985264Ensembl.1
Natural variantiVAR_077740399R → C Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs150882180Ensembl.1
Natural variantiVAR_077741404G → A Polymorphism; does not affect subcellular location; increases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs371536090Ensembl.1
Natural variantiVAR_077742405Q → P Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs145663007Ensembl.1
Natural variantiVAR_077743410I → V Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs376489706Ensembl.1
Natural variantiVAR_077744411P → S Polymorphism; does not affect subcellular location; increases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs147757048Ensembl.1
Natural variantiVAR_077745413E → K Polymorphism; does not affect subcellular location; increases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs142628291Ensembl.1
Natural variantiVAR_077746419A → V Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs370959644Ensembl.1
Natural variantiVAR_077747425G → S Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs374575404Ensembl.1
Natural variantiVAR_077748441A → T Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs375271891Ensembl.1
Natural variantiVAR_077749448A → D Polymorphism; reduces cell membrane location; decreases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs200173874Ensembl.1
Natural variantiVAR_077750450H → R Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs200060202Ensembl.1
Natural variantiVAR_077751453D → N Polymorphism; does not affect subcellular location; increases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs149065791Ensembl.1
Natural variantiVAR_077752454C → Y Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs143062748Ensembl.1
Natural variantiVAR_077753458A → T Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs140426880Ensembl.1
Natural variantiVAR_077754464S → A Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs78638447Ensembl.1
Natural variantiVAR_077755476N → S Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs138163855Ensembl.1
Natural variantiVAR_077756478S → L Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs372643228Ensembl.1
Natural variantiVAR_077757484T → M Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs149266247Ensembl.1
Natural variantiVAR_077758485V → I Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs369012277Ensembl.1
Natural variantiVAR_077759498E → G Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs200576124Ensembl.1
Natural variantiVAR_077760499A → S Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs150620459Ensembl.1
Natural variantiVAR_049461508V → M Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs11833801Ensembl.1
Natural variantiVAR_049462523S → L Polymorphism; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs11061318Ensembl.1
Natural variantiVAR_077761524N → K Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs370443698Ensembl.1
Natural variantiVAR_077762538V → A Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs201849687Ensembl.1
Natural variantiVAR_077763538V → I Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs200971352Ensembl.1
Natural variantiVAR_077764540R → C Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs147294464Ensembl.1
Natural variantiVAR_077765540R → H Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs145630930Ensembl.1
Natural variantiVAR_077766560R → C Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs371989819Ensembl.1
Natural variantiVAR_077767560R → H Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs375179921Ensembl.1
Natural variantiVAR_077768567S → L Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs192515185Ensembl.1
Natural variantiVAR_077769569I → V Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs139017446Ensembl.1
Natural variantiVAR_077770589A → T Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs201161291Ensembl.1
Natural variantiVAR_077771594V → M Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs189007948Ensembl.1
Natural variantiVAR_077772601R → H Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs201524753Ensembl.1
Natural variantiVAR_077773608L → M Polymorphism; does not affect subcellular location; decreases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs200052797Ensembl.1
Natural variantiVAR_077774624R → C Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs117457351Ensembl.1
Natural variantiVAR_077775626E → K Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs199778477Ensembl.1
Natural variantiVAR_077776630T → I Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs145482553Ensembl.1
Natural variantiVAR_077777667S → L Polymorphism; does not affect subcellular location; decreases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs377401276Ensembl.1
Natural variantiVAR_077778673R → H Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs141128784Ensembl.1
Natural variantiVAR_077779695M → T Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs143163307Ensembl.1
Natural variantiVAR_077780699G → V Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 Publication1
Natural variantiVAR_077781720A → V Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs141439159Ensembl.1
Natural variantiVAR_077782743A → T Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs143902981Ensembl.1
Natural variantiVAR_077783749H → R Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs372207677Ensembl.1
Natural variantiVAR_077784751D → E Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs147763331Ensembl.1
Natural variantiVAR_077785761A → E Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs369201469Ensembl.1
Natural variantiVAR_077786764V → M Polymorphism; reduces cell membrane location; decreases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs149434203Ensembl.1
Natural variantiVAR_077787777V → M Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs144814859Ensembl.1
Natural variantiVAR_077788779A → V Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs61746588Ensembl.1
Natural variantiVAR_077789793T → M Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs375488636Ensembl.1
Natural variantiVAR_077790795N → K Polymorphism; decreases cell surface location; abolishes G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs369853823Ensembl.1
Natural variantiVAR_077791816A → T Polymorphism; reduces cell membrane location; decreases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs368828722Ensembl.1
Natural variantiVAR_077792827T → M Polymorphism; does not affect subcellular location; increases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs371135988Ensembl.1
Natural variantiVAR_077793831A → T Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs146661482Ensembl.1
Natural variantiVAR_077794836A → T Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs144023497Ensembl.1
Natural variantiVAR_077795836A → V Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs367789023Ensembl.1
Natural variantiVAR_077796851M → T Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs78058857Ensembl.1
Natural variantiVAR_077797868R → H Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs61740366Ensembl.1
Natural variantiVAR_077798869V → I Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs377434309Ensembl.1
Natural variantiVAR_077799870D → N Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs143670024Ensembl.1
Natural variantiVAR_077800874V → M Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs148442158Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0127871 – 481Missing in isoform 3. 1 PublicationAdd BLAST481
Alternative sequenceiVSP_0127881 – 314Missing in isoform 2. 1 PublicationAdd BLAST314
Alternative sequenceiVSP_05367862G → GASRTHKLTVLPSRNATFVY SNDSAYSNLSATV in isoform 4. 1 Publication1
Alternative sequenceiVSP_012789315 – 341QTALN…WIALS → MEKGTELLVSPSQSGPGGDQ PLLVKHR in isoform 2. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_012790482 – 491LITVHLKHRL → MHRVCFLSFQ in isoform 3. 1 Publication10

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY532280 mRNA. Translation: AAS37682.1.
AY278561 mRNA. Translation: AAP35063.1.
EU523118 mRNA. Translation: ACB20802.1.
AK131538 mRNA. Translation: BAD18674.1.
AC073862 Genomic DNA. No translation available.
AC078925 Genomic DNA. No translation available.
AC126564 Genomic DNA. No translation available.
BC112307 mRNA. Translation: AAI12308.1.
BC112309 mRNA. Translation: AAI12310.1.
BC143775 mRNA. Translation: AAI43776.1.
AY255587 mRNA. Translation: AAO85099.1.
CCDSiCCDS81753.1. [Q6QNK2-4]
CCDS9272.1. [Q6QNK2-1]
PIRiT47186.
RefSeqiNP_001317426.1. NM_001330497.1. [Q6QNK2-4]
NP_942122.2. NM_198827.4. [Q6QNK2-1]
UniGeneiHs.719239.

Genome annotation databases

EnsembliENST00000261654; ENSP00000261654; ENSG00000111452. [Q6QNK2-1]
ENST00000535015; ENSP00000444425; ENSG00000111452. [Q6QNK2-4]
ENST00000543617; ENSP00000438021; ENSG00000111452. [Q6QNK2-3]
GeneIDi283383.
KEGGihsa:283383.
UCSCiuc001uit.5. human. [Q6QNK2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.

Entry informationi

Entry nameiAGRD1_HUMAN
AccessioniPrimary (citable) accession number: Q6QNK2
Secondary accession number(s): B2CKK9
, B7ZLF7, Q2M1L3, Q6ZMQ1, Q7Z7M2, Q86SM4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 15, 2005
Last sequence update: July 5, 2004
Last modified: May 10, 2017
This is version 122 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families