Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6QNK2

- GP133_HUMAN

UniProt

Q6QNK2 - GP133_HUMAN

Protein

Probable G-protein coupled receptor 133

Gene

GPR133

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 98 (01 Oct 2014)
      Sequence version 1 (05 Jul 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Orphan receptor.

    GO - Molecular functioni

    1. G-protein coupled receptor activity Source: GDB

    GO - Biological processi

    1. G-protein coupled receptor signaling pathway Source: GDB
    2. neuropeptide signaling pathway Source: InterPro

    Keywords - Molecular functioni

    G-protein coupled receptor, Receptor, Transducer

    Protein family/group databases

    MEROPSiS63.024.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Probable G-protein coupled receptor 133
    Alternative name(s):
    G-protein coupled receptor PGR25
    Gene namesi
    Name:GPR133
    Synonyms:PGR25
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:19893. GPR133.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: GDB
    2. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134923933.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2525Sequence AnalysisAdd
    BLAST
    Chaini26 – 874849Probable G-protein coupled receptor 133PRO_0000012905Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi90 – 901N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi185 – 1851N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi282 – 2821N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi302 – 3021N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi319 – 3191N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi394 – 3941N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi476 – 4761N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi501 – 5011N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi533 – 5331N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    PaxDbiQ6QNK2.
    PRIDEiQ6QNK2.

    PTM databases

    PhosphoSiteiQ6QNK2.

    Expressioni

    Gene expression databases

    ArrayExpressiQ6QNK2.
    BgeeiQ6QNK2.
    CleanExiHS_GPR133.
    GenevestigatoriQ6QNK2.

    Organism-specific databases

    HPAiHPA042395.

    Interactioni

    Protein-protein interaction databases

    STRINGi9606.ENSP00000261654.

    Structurei

    3D structure databases

    ProteinModelPortaliQ6QNK2.
    SMRiQ6QNK2. Positions 569-815.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini26 – 570545ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini592 – 60211CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini624 – 63310ExtracellularSequence Analysis
    Topological domaini655 – 67420CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini696 – 71116ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini733 – 76028CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini782 – 7843ExtracellularSequence Analysis
    Topological domaini806 – 87469CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei571 – 59121Helical; Name=1Sequence AnalysisAdd
    BLAST
    Transmembranei603 – 62321Helical; Name=2Sequence AnalysisAdd
    BLAST
    Transmembranei634 – 65421Helical; Name=3Sequence AnalysisAdd
    BLAST
    Transmembranei675 – 69521Helical; Name=4Sequence AnalysisAdd
    BLAST
    Transmembranei712 – 73221Helical; Name=5Sequence AnalysisAdd
    BLAST
    Transmembranei761 – 78121Helical; Name=6Sequence AnalysisAdd
    BLAST
    Transmembranei785 – 80521Helical; Name=7Sequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini507 – 55650GPSPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 GPS domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG247313.
    HOVERGENiHBG051779.
    InParanoidiQ6QNK2.
    KOiK08465.
    OMAiDEIAMYF.
    OrthoDBiEOG7966FS.
    PhylomeDBiQ6QNK2.
    TreeFamiTF351999.

    Family and domain databases

    Gene3Di2.60.120.200. 1 hit.
    InterProiIPR008985. ConA-like_lec_gl_sf.
    IPR013320. ConA-like_subgrp.
    IPR017981. GPCR_2-like.
    IPR000832. GPCR_2_secretin-like.
    IPR017983. GPCR_2_secretin-like_CS.
    IPR000203. GPS.
    [Graphical view]
    PfamiPF00002. 7tm_2. 1 hit.
    PF01825. GPS. 1 hit.
    [Graphical view]
    PRINTSiPR00249. GPCRSECRETIN.
    SMARTiSM00303. GPS. 1 hit.
    [Graphical view]
    SUPFAMiSSF49899. SSF49899. 1 hit.
    PROSITEiPS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
    PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
    PS50221. GPS. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6QNK2-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEKLLRLCCW YSWLLLFYYN FQVRGVYSRS QDHPGFQVLA SASHYWPLEN    50
    VDGIHELQDT TGDIVEGKVN KGIYLKEEKG VTLLYYGRYN SSCISKPEQC 100
    GPEGVTFSFF WKTQGEQSRP IPSAYGGQVI SNGFKVCSSG GRGSVELYTR 150
    DNSMTWEASF SPPGPYWTHV LFTWKSKEGL KVYVNGTLST SDPSGKVSRD 200
    YGESNVNLVI GSEQDQAKCY ENGAFDEFII WERALTPDEI AMYFTAAIGK 250
    HALLSSTLPS LFMTSTASPV MPTDAYHPII TNLTEERKTF QSPGVILSYL 300
    QNVSLSLPSK SLSEQTALNL TKTFLKAVGE ILLLPGWIAL SEDSAVVLSL 350
    IDTIDTVMGH VSSNLHGSTP QVTVEGSSAM AEFSVAKILP KTVNSSHYRF 400
    PAHGQSFIQI PHEAFHRHAW STVVGLLYHS MHYYLNNIWP AHTKIAEAMH 450
    HQDCLLFATS HLISLEVSPP PTLSQNLSGS PLITVHLKHR LTRKQHSEAT 500
    NSSNRVFVYC AFLDFSSGEG VWSNHGCALT RGNLTYSVCR CTHLTNFAIL 550
    MQVVPLELAR GHQVALSSIS YVGCSLSVLC LVATLVTFAV LSSVSTIRNQ 600
    RYHIHANLSF AVLVAQVLLL ISFRLEPGTT PCQVMAVLLH YFFLSAFAWM 650
    LVEGLHLYSM VIKVFGSEDS KHRYYYGMGW GFPLLICIIS LSFAMDSYGT 700
    SNNCWLSLAS GAIWAFVAPA LFVIVVNIGI LIAVTRVISQ ISADNYKIHG 750
    DPSAFKLTAK AVAVLLPILG TSWVFGVLAV NGCAVVFQYM FATLNSLQGL 800
    FIFLFHCLLN SEVRAAFKHK TKVWSLTSSS ARTSNAKPFH SDLMNGTRPG 850
    MASTKLSPWD KSSHSAHRVD LSAV 874
    Length:874
    Mass (Da):96,530
    Last modified:July 5, 2004 - v1
    Checksum:i8FC7C63D50F65E1B
    GO
    Isoform 2 (identifier: Q6QNK2-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-314: Missing.
         315-341: QTALNLTKTFLKAVGEILLLPGWIALS → MEKGTELLVSPSQSGPGGDQPLLVKHR

    Note: No experimental confirmation available.

    Show »
    Length:560
    Mass (Da):61,360
    Checksum:i3191A83261A5078D
    GO
    Isoform 3 (identifier: Q6QNK2-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-481: Missing.
         482-491: LITVHLKHRL → MHRVCFLSFQ

    Note: No experimental confirmation available.

    Show »
    Length:393
    Mass (Da):43,210
    Checksum:iD108A3060EA93E60
    GO
    Isoform 4 (identifier: Q6QNK2-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         62-62: G → GASRTHKLTVLPSRNATFVYSNDSAYSNLSATV

    Note: No experimental confirmation available.

    Show »
    Length:906
    Mass (Da):99,984
    Checksum:i1C8D7423F602F3E8
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti703 – 7031N → S in AAP35063. (PubMed:15203201)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti508 – 5081V → M.
    Corresponds to variant rs11833801 [ dbSNP | Ensembl ].
    VAR_049461
    Natural varianti523 – 5231S → L.
    Corresponds to variant rs11061318 [ dbSNP | Ensembl ].
    VAR_049462

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 481481Missing in isoform 3. 1 PublicationVSP_012787Add
    BLAST
    Alternative sequencei1 – 314314Missing in isoform 2. 1 PublicationVSP_012788Add
    BLAST
    Alternative sequencei62 – 621G → GASRTHKLTVLPSRNATFVY SNDSAYSNLSATV in isoform 4. 1 PublicationVSP_053678
    Alternative sequencei315 – 34127QTALN…WIALS → MEKGTELLVSPSQSGPGGDQ PLLVKHR in isoform 2. 1 PublicationVSP_012789Add
    BLAST
    Alternative sequencei482 – 49110LITVHLKHRL → MHRVCFLSFQ in isoform 3. 1 PublicationVSP_012790

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY532280 mRNA. Translation: AAS37682.1.
    AY278561 mRNA. Translation: AAP35063.1.
    EU523118 mRNA. Translation: ACB20802.1.
    AK131538 mRNA. Translation: BAD18674.1.
    AC073862 Genomic DNA. No translation available.
    AC078925 Genomic DNA. No translation available.
    AC126564 Genomic DNA. No translation available.
    BC112307 mRNA. Translation: AAI12308.1.
    BC112309 mRNA. Translation: AAI12310.1.
    BC143775 mRNA. Translation: AAI43776.1.
    AY255587 mRNA. Translation: AAO85099.1.
    CCDSiCCDS9272.1. [Q6QNK2-1]
    PIRiT47186.
    RefSeqiNP_942122.2. NM_198827.3. [Q6QNK2-1]
    UniGeneiHs.719239.

    Genome annotation databases

    EnsembliENST00000261654; ENSP00000261654; ENSG00000111452. [Q6QNK2-1]
    ENST00000535015; ENSP00000444425; ENSG00000111452. [Q6QNK2-4]
    ENST00000543617; ENSP00000438021; ENSG00000111452. [Q6QNK2-3]
    GeneIDi283383.
    KEGGihsa:283383.
    UCSCiuc001uit.4. human. [Q6QNK2-1]
    uc001uiv.1. human. [Q6QNK2-3]
    uc010tbm.2. human.

    Polymorphism databases

    DMDMi59797935.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY532280 mRNA. Translation: AAS37682.1 .
    AY278561 mRNA. Translation: AAP35063.1 .
    EU523118 mRNA. Translation: ACB20802.1 .
    AK131538 mRNA. Translation: BAD18674.1 .
    AC073862 Genomic DNA. No translation available.
    AC078925 Genomic DNA. No translation available.
    AC126564 Genomic DNA. No translation available.
    BC112307 mRNA. Translation: AAI12308.1 .
    BC112309 mRNA. Translation: AAI12310.1 .
    BC143775 mRNA. Translation: AAI43776.1 .
    AY255587 mRNA. Translation: AAO85099.1 .
    CCDSi CCDS9272.1. [Q6QNK2-1 ]
    PIRi T47186.
    RefSeqi NP_942122.2. NM_198827.3. [Q6QNK2-1 ]
    UniGenei Hs.719239.

    3D structure databases

    ProteinModelPortali Q6QNK2.
    SMRi Q6QNK2. Positions 569-815.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000261654.

    Protein family/group databases

    MEROPSi S63.024.
    GPCRDBi Search...

    PTM databases

    PhosphoSitei Q6QNK2.

    Polymorphism databases

    DMDMi 59797935.

    Proteomic databases

    PaxDbi Q6QNK2.
    PRIDEi Q6QNK2.

    Protocols and materials databases

    DNASUi 283383.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000261654 ; ENSP00000261654 ; ENSG00000111452 . [Q6QNK2-1 ]
    ENST00000535015 ; ENSP00000444425 ; ENSG00000111452 . [Q6QNK2-4 ]
    ENST00000543617 ; ENSP00000438021 ; ENSG00000111452 . [Q6QNK2-3 ]
    GeneIDi 283383.
    KEGGi hsa:283383.
    UCSCi uc001uit.4. human. [Q6QNK2-1 ]
    uc001uiv.1. human. [Q6QNK2-3 ]
    uc010tbm.2. human.

    Organism-specific databases

    CTDi 283383.
    GeneCardsi GC12P131438.
    HGNCi HGNC:19893. GPR133.
    HPAi HPA042395.
    MIMi 613639. gene.
    neXtProti NX_Q6QNK2.
    PharmGKBi PA134923933.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG247313.
    HOVERGENi HBG051779.
    InParanoidi Q6QNK2.
    KOi K08465.
    OMAi DEIAMYF.
    OrthoDBi EOG7966FS.
    PhylomeDBi Q6QNK2.
    TreeFami TF351999.

    Miscellaneous databases

    GenomeRNAii 283383.
    NextBioi 35481285.
    PROi Q6QNK2.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q6QNK2.
    Bgeei Q6QNK2.
    CleanExi HS_GPR133.
    Genevestigatori Q6QNK2.

    Family and domain databases

    Gene3Di 2.60.120.200. 1 hit.
    InterProi IPR008985. ConA-like_lec_gl_sf.
    IPR013320. ConA-like_subgrp.
    IPR017981. GPCR_2-like.
    IPR000832. GPCR_2_secretin-like.
    IPR017983. GPCR_2_secretin-like_CS.
    IPR000203. GPS.
    [Graphical view ]
    Pfami PF00002. 7tm_2. 1 hit.
    PF01825. GPS. 1 hit.
    [Graphical view ]
    PRINTSi PR00249. GPCRSECRETIN.
    SMARTi SM00303. GPS. 1 hit.
    [Graphical view ]
    SUPFAMi SSF49899. SSF49899. 1 hit.
    PROSITEi PS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
    PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
    PS50221. GPS. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Bonner T.I., Nagle J.W., Kauffman D.
      Submitted (JAN-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Brain.
    2. "The human and mouse repertoire of the adhesion family of G-protein-coupled receptors."
      Bjarnadottir T.K., Fredriksson R., Hoeglund P.J., Gloriam D.E., Lagerstroem M.C., Schioeth H.B.
      Genomics 84:23-33(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
    3. "Common splice variant of human GPR133 in brain."
      Bonner T.I., Sloger M., Nagle J.W., Kauffman D.
      Submitted (FEB-2008) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), ALTERNATIVE SPLICING.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Brain.
    5. "The finished DNA sequence of human chromosome 12."
      Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
      , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
      Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4).
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 355-708.

    Entry informationi

    Entry nameiGP133_HUMAN
    AccessioniPrimary (citable) accession number: Q6QNK2
    Secondary accession number(s): B2CKK9
    , B7ZLF7, Q2M1L3, Q6ZMQ1, Q7Z7M2, Q86SM4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 15, 2005
    Last sequence update: July 5, 2004
    Last modified: October 1, 2014
    This is version 98 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. 7-transmembrane G-linked receptors
      List of 7-transmembrane G-linked receptor entries
    2. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3