Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q6QNK2 (GP133_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 94. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Probable G-protein coupled receptor 133
Alternative name(s):
G-protein coupled receptor PGR25
Gene names
Name:GPR133
Synonyms:PGR25
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length874 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Orphan receptor.

Subcellular location

Cell membrane; Multi-pass membrane protein.

Sequence similarities

Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily.

Contains 1 GPS domain.

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q6QNK2-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q6QNK2-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-314: Missing.
     315-341: QTALNLTKTFLKAVGEILLLPGWIALS → MEKGTELLVSPSQSGPGGDQPLLVKHR
Note: No experimental confirmation available.
Isoform 3 (identifier: Q6QNK2-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-481: Missing.
     482-491: LITVHLKHRL → MHRVCFLSFQ
Note: No experimental confirmation available.
Isoform 4 (identifier: Q6QNK2-4)

The sequence of this isoform differs from the canonical sequence as follows:
     62-62: G → GASRTHKLTVLPSRNATFVYSNDSAYSNLSATV
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2525 Potential
Chain26 – 874849Probable G-protein coupled receptor 133
PRO_0000012905

Regions

Topological domain26 – 570545Extracellular Potential
Transmembrane571 – 59121Helical; Name=1; Potential
Topological domain592 – 60211Cytoplasmic Potential
Transmembrane603 – 62321Helical; Name=2; Potential
Topological domain624 – 63310Extracellular Potential
Transmembrane634 – 65421Helical; Name=3; Potential
Topological domain655 – 67420Cytoplasmic Potential
Transmembrane675 – 69521Helical; Name=4; Potential
Topological domain696 – 71116Extracellular Potential
Transmembrane712 – 73221Helical; Name=5; Potential
Topological domain733 – 76028Cytoplasmic Potential
Transmembrane761 – 78121Helical; Name=6; Potential
Topological domain782 – 7843Extracellular Potential
Transmembrane785 – 80521Helical; Name=7; Potential
Topological domain806 – 87469Cytoplasmic Potential
Domain507 – 55650GPS

Amino acid modifications

Glycosylation901N-linked (GlcNAc...) Potential
Glycosylation1851N-linked (GlcNAc...) Potential
Glycosylation2821N-linked (GlcNAc...) Potential
Glycosylation3021N-linked (GlcNAc...) Potential
Glycosylation3191N-linked (GlcNAc...) Potential
Glycosylation3941N-linked (GlcNAc...) Potential
Glycosylation4761N-linked (GlcNAc...) Potential
Glycosylation5011N-linked (GlcNAc...) Potential
Glycosylation5331N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence1 – 481481Missing in isoform 3.
VSP_012787
Alternative sequence1 – 314314Missing in isoform 2.
VSP_012788
Alternative sequence621G → GASRTHKLTVLPSRNATFVY SNDSAYSNLSATV in isoform 4.
VSP_053678
Alternative sequence315 – 34127QTALN…WIALS → MEKGTELLVSPSQSGPGGDQ PLLVKHR in isoform 2.
VSP_012789
Alternative sequence482 – 49110LITVHLKHRL → MHRVCFLSFQ in isoform 3.
VSP_012790
Natural variant5081V → M.
Corresponds to variant rs11833801 [ dbSNP | Ensembl ].
VAR_049461
Natural variant5231S → L.
Corresponds to variant rs11061318 [ dbSNP | Ensembl ].
VAR_049462

Experimental info

Sequence conflict7031N → S in AAP35063. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 5, 2004. Version 1.
Checksum: 8FC7C63D50F65E1B

FASTA87496,530
        10         20         30         40         50         60 
MEKLLRLCCW YSWLLLFYYN FQVRGVYSRS QDHPGFQVLA SASHYWPLEN VDGIHELQDT 

        70         80         90        100        110        120 
TGDIVEGKVN KGIYLKEEKG VTLLYYGRYN SSCISKPEQC GPEGVTFSFF WKTQGEQSRP 

       130        140        150        160        170        180 
IPSAYGGQVI SNGFKVCSSG GRGSVELYTR DNSMTWEASF SPPGPYWTHV LFTWKSKEGL 

       190        200        210        220        230        240 
KVYVNGTLST SDPSGKVSRD YGESNVNLVI GSEQDQAKCY ENGAFDEFII WERALTPDEI 

       250        260        270        280        290        300 
AMYFTAAIGK HALLSSTLPS LFMTSTASPV MPTDAYHPII TNLTEERKTF QSPGVILSYL 

       310        320        330        340        350        360 
QNVSLSLPSK SLSEQTALNL TKTFLKAVGE ILLLPGWIAL SEDSAVVLSL IDTIDTVMGH 

       370        380        390        400        410        420 
VSSNLHGSTP QVTVEGSSAM AEFSVAKILP KTVNSSHYRF PAHGQSFIQI PHEAFHRHAW 

       430        440        450        460        470        480 
STVVGLLYHS MHYYLNNIWP AHTKIAEAMH HQDCLLFATS HLISLEVSPP PTLSQNLSGS 

       490        500        510        520        530        540 
PLITVHLKHR LTRKQHSEAT NSSNRVFVYC AFLDFSSGEG VWSNHGCALT RGNLTYSVCR 

       550        560        570        580        590        600 
CTHLTNFAIL MQVVPLELAR GHQVALSSIS YVGCSLSVLC LVATLVTFAV LSSVSTIRNQ 

       610        620        630        640        650        660 
RYHIHANLSF AVLVAQVLLL ISFRLEPGTT PCQVMAVLLH YFFLSAFAWM LVEGLHLYSM 

       670        680        690        700        710        720 
VIKVFGSEDS KHRYYYGMGW GFPLLICIIS LSFAMDSYGT SNNCWLSLAS GAIWAFVAPA 

       730        740        750        760        770        780 
LFVIVVNIGI LIAVTRVISQ ISADNYKIHG DPSAFKLTAK AVAVLLPILG TSWVFGVLAV 

       790        800        810        820        830        840 
NGCAVVFQYM FATLNSLQGL FIFLFHCLLN SEVRAAFKHK TKVWSLTSSS ARTSNAKPFH 

       850        860        870 
SDLMNGTRPG MASTKLSPWD KSSHSAHRVD LSAV 

« Hide

Isoform 2 [UniParc].

Checksum: 3191A83261A5078D
Show »

FASTA56061,360
Isoform 3 [UniParc].

Checksum: D108A3060EA93E60
Show »

FASTA39343,210
Isoform 4 [UniParc].

Checksum: 1C8D7423F602F3E8
Show »

FASTA90699,984

References

« Hide 'large scale' references
[1]Bonner T.I., Nagle J.W., Kauffman D.
Submitted (JAN-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Brain.
[2]"The human and mouse repertoire of the adhesion family of G-protein-coupled receptors."
Bjarnadottir T.K., Fredriksson R., Hoeglund P.J., Gloriam D.E., Lagerstroem M.C., Schioeth H.B.
Genomics 84:23-33(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
[3]"Common splice variant of human GPR133 in brain."
Bonner T.I., Sloger M., Nagle J.W., Kauffman D.
Submitted (FEB-2008) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), ALTERNATIVE SPLICING.
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Brain.
[5]"The finished DNA sequence of human chromosome 12."
Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. expand/collapse author list , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4).
[7]"The G protein-coupled receptor repertoires of human and mouse."
Vassilatis D.K., Hohmann J.G., Zeng H., Li F., Ranchalis J.E., Mortrud M.T., Brown A., Rodriguez S.S., Weller J.R., Wright A.C., Bergmann J.E., Gaitanaris G.A.
Proc. Natl. Acad. Sci. U.S.A. 100:4903-4908(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 355-708.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY532280 mRNA. Translation: AAS37682.1.
AY278561 mRNA. Translation: AAP35063.1.
EU523118 mRNA. Translation: ACB20802.1.
AK131538 mRNA. Translation: BAD18674.1.
AC073862 Genomic DNA. No translation available.
AC078925 Genomic DNA. No translation available.
AC126564 Genomic DNA. No translation available.
BC112307 mRNA. Translation: AAI12308.1.
BC112309 mRNA. Translation: AAI12310.1.
BC143775 mRNA. Translation: AAI43776.1.
AY255587 mRNA. Translation: AAO85099.1.
PIRT47186.
RefSeqNP_942122.2. NM_198827.3.
UniGeneHs.719239.

3D structure databases

ProteinModelPortalQ6QNK2.
SMRQ6QNK2. Positions 550-829.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000261654.

Protein family/group databases

MEROPSS63.024.
GPCRDBSearch...

PTM databases

PhosphoSiteQ6QNK2.

Polymorphism databases

DMDM59797935.

Proteomic databases

PaxDbQ6QNK2.
PRIDEQ6QNK2.

Protocols and materials databases

DNASU283383.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000261654; ENSP00000261654; ENSG00000111452. [Q6QNK2-1]
ENST00000376682; ENSP00000365872; ENSG00000111452. [Q6QNK2-2]
ENST00000535015; ENSP00000444425; ENSG00000111452. [Q6QNK2-4]
ENST00000543617; ENSP00000438021; ENSG00000111452. [Q6QNK2-3]
GeneID283383.
KEGGhsa:283383.
UCSCuc001uit.4. human. [Q6QNK2-1]
uc001uiv.1. human. [Q6QNK2-3]
uc010tbm.2. human.

Organism-specific databases

CTD283383.
GeneCardsGC12P131438.
HGNCHGNC:19893. GPR133.
HPAHPA042395.
MIM613639. gene.
neXtProtNX_Q6QNK2.
PharmGKBPA134923933.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG247313.
HOVERGENHBG051779.
InParanoidQ6QNK2.
KOK08465.
OrthoDBEOG7966FS.
PhylomeDBQ6QNK2.
TreeFamTF351999.

Gene expression databases

ArrayExpressQ6QNK2.
BgeeQ6QNK2.
CleanExHS_GPR133.
GenevestigatorQ6QNK2.

Family and domain databases

Gene3D2.60.120.200. 1 hit.
InterProIPR008985. ConA-like_lec_gl_sf.
IPR013320. ConA-like_subgrp.
IPR017981. GPCR_2-like.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
[Graphical view]
PfamPF00002. 7tm_2. 1 hit.
PF01825. GPS. 1 hit.
[Graphical view]
PRINTSPR00249. GPCRSECRETIN.
SMARTSM00303. GPS. 1 hit.
[Graphical view]
SUPFAMSSF49899. SSF49899. 1 hit.
PROSITEPS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi283383.
NextBio35481285.
PROQ6QNK2.
SOURCESearch...

Entry information

Entry nameGP133_HUMAN
AccessionPrimary (citable) accession number: Q6QNK2
Secondary accession number(s): B2CKK9 expand/collapse secondary AC list , B7ZLF7, Q2M1L3, Q6ZMQ1, Q7Z7M2, Q86SM4
Entry history
Integrated into UniProtKB/Swiss-Prot: February 15, 2005
Last sequence update: July 5, 2004
Last modified: April 16, 2014
This is version 94 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 12

Human chromosome 12: entries, gene names and cross-references to MIM

7-transmembrane G-linked receptors

List of 7-transmembrane G-linked receptor entries