Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6QNK2

- GP133_HUMAN

UniProt

Q6QNK2 - GP133_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Probable G-protein coupled receptor 133

Gene

GPR133

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli

Functioni

Orphan receptor.

GO - Molecular functioni

  1. G-protein coupled receptor activity Source: GDB

GO - Biological processi

  1. G-protein coupled receptor signaling pathway Source: GDB
  2. neuropeptide signaling pathway Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Protein family/group databases

MEROPSiS63.024.

Names & Taxonomyi

Protein namesi
Recommended name:
Probable G-protein coupled receptor 133
Alternative name(s):
G-protein coupled receptor PGR25
Gene namesi
Name:GPR133
Synonyms:PGR25
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:19893. GPR133.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini26 – 570545ExtracellularSequence AnalysisAdd
BLAST
Transmembranei571 – 59121Helical; Name=1Sequence AnalysisAdd
BLAST
Topological domaini592 – 60211CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei603 – 62321Helical; Name=2Sequence AnalysisAdd
BLAST
Topological domaini624 – 63310ExtracellularSequence Analysis
Transmembranei634 – 65421Helical; Name=3Sequence AnalysisAdd
BLAST
Topological domaini655 – 67420CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei675 – 69521Helical; Name=4Sequence AnalysisAdd
BLAST
Topological domaini696 – 71116ExtracellularSequence AnalysisAdd
BLAST
Transmembranei712 – 73221Helical; Name=5Sequence AnalysisAdd
BLAST
Topological domaini733 – 76028CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei761 – 78121Helical; Name=6Sequence AnalysisAdd
BLAST
Topological domaini782 – 7843ExtracellularSequence Analysis
Transmembranei785 – 80521Helical; Name=7Sequence AnalysisAdd
BLAST
Topological domaini806 – 87469CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: GDB
  2. plasma membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134923933.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2525Sequence AnalysisAdd
BLAST
Chaini26 – 874849Probable G-protein coupled receptor 133PRO_0000012905Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi90 – 901N-linked (GlcNAc...)Sequence Analysis
Glycosylationi185 – 1851N-linked (GlcNAc...)Sequence Analysis
Glycosylationi282 – 2821N-linked (GlcNAc...)Sequence Analysis
Glycosylationi302 – 3021N-linked (GlcNAc...)Sequence Analysis
Glycosylationi319 – 3191N-linked (GlcNAc...)Sequence Analysis
Glycosylationi394 – 3941N-linked (GlcNAc...)Sequence Analysis
Glycosylationi476 – 4761N-linked (GlcNAc...)Sequence Analysis
Glycosylationi501 – 5011N-linked (GlcNAc...)Sequence Analysis
Glycosylationi533 – 5331N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ6QNK2.
PRIDEiQ6QNK2.

PTM databases

PhosphoSiteiQ6QNK2.

Expressioni

Gene expression databases

BgeeiQ6QNK2.
CleanExiHS_GPR133.
ExpressionAtlasiQ6QNK2. baseline and differential.
GenevestigatoriQ6QNK2.

Organism-specific databases

HPAiHPA042395.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000261654.

Structurei

3D structure databases

ProteinModelPortaliQ6QNK2.
SMRiQ6QNK2. Positions 569-815.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini507 – 55650GPSPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 GPS domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG247313.
GeneTreeiENSGT00760000118787.
HOVERGENiHBG051779.
InParanoidiQ6QNK2.
KOiK08465.
OMAiDEIAMYF.
OrthoDBiEOG7966FS.
PhylomeDBiQ6QNK2.
TreeFamiTF351999.

Family and domain databases

Gene3Di2.60.120.200. 1 hit.
InterProiIPR013320. ConA-like_dom.
IPR017981. GPCR_2-like.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
[Graphical view]
PfamiPF00002. 7tm_2. 1 hit.
PF01825. GPS. 1 hit.
[Graphical view]
PRINTSiPR00249. GPCRSECRETIN.
SMARTiSM00303. GPS. 1 hit.
[Graphical view]
SUPFAMiSSF49899. SSF49899. 1 hit.
PROSITEiPS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6QNK2-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEKLLRLCCW YSWLLLFYYN FQVRGVYSRS QDHPGFQVLA SASHYWPLEN
60 70 80 90 100
VDGIHELQDT TGDIVEGKVN KGIYLKEEKG VTLLYYGRYN SSCISKPEQC
110 120 130 140 150
GPEGVTFSFF WKTQGEQSRP IPSAYGGQVI SNGFKVCSSG GRGSVELYTR
160 170 180 190 200
DNSMTWEASF SPPGPYWTHV LFTWKSKEGL KVYVNGTLST SDPSGKVSRD
210 220 230 240 250
YGESNVNLVI GSEQDQAKCY ENGAFDEFII WERALTPDEI AMYFTAAIGK
260 270 280 290 300
HALLSSTLPS LFMTSTASPV MPTDAYHPII TNLTEERKTF QSPGVILSYL
310 320 330 340 350
QNVSLSLPSK SLSEQTALNL TKTFLKAVGE ILLLPGWIAL SEDSAVVLSL
360 370 380 390 400
IDTIDTVMGH VSSNLHGSTP QVTVEGSSAM AEFSVAKILP KTVNSSHYRF
410 420 430 440 450
PAHGQSFIQI PHEAFHRHAW STVVGLLYHS MHYYLNNIWP AHTKIAEAMH
460 470 480 490 500
HQDCLLFATS HLISLEVSPP PTLSQNLSGS PLITVHLKHR LTRKQHSEAT
510 520 530 540 550
NSSNRVFVYC AFLDFSSGEG VWSNHGCALT RGNLTYSVCR CTHLTNFAIL
560 570 580 590 600
MQVVPLELAR GHQVALSSIS YVGCSLSVLC LVATLVTFAV LSSVSTIRNQ
610 620 630 640 650
RYHIHANLSF AVLVAQVLLL ISFRLEPGTT PCQVMAVLLH YFFLSAFAWM
660 670 680 690 700
LVEGLHLYSM VIKVFGSEDS KHRYYYGMGW GFPLLICIIS LSFAMDSYGT
710 720 730 740 750
SNNCWLSLAS GAIWAFVAPA LFVIVVNIGI LIAVTRVISQ ISADNYKIHG
760 770 780 790 800
DPSAFKLTAK AVAVLLPILG TSWVFGVLAV NGCAVVFQYM FATLNSLQGL
810 820 830 840 850
FIFLFHCLLN SEVRAAFKHK TKVWSLTSSS ARTSNAKPFH SDLMNGTRPG
860 870
MASTKLSPWD KSSHSAHRVD LSAV
Length:874
Mass (Da):96,530
Last modified:July 5, 2004 - v1
Checksum:i8FC7C63D50F65E1B
GO
Isoform 2 (identifier: Q6QNK2-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-314: Missing.
     315-341: QTALNLTKTFLKAVGEILLLPGWIALS → MEKGTELLVSPSQSGPGGDQPLLVKHR

Note: No experimental confirmation available.

Show »
Length:560
Mass (Da):61,360
Checksum:i3191A83261A5078D
GO
Isoform 3 (identifier: Q6QNK2-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-481: Missing.
     482-491: LITVHLKHRL → MHRVCFLSFQ

Note: No experimental confirmation available.

Show »
Length:393
Mass (Da):43,210
Checksum:iD108A3060EA93E60
GO
Isoform 4 (identifier: Q6QNK2-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     62-62: G → GASRTHKLTVLPSRNATFVYSNDSAYSNLSATV

Note: No experimental confirmation available.

Show »
Length:906
Mass (Da):99,984
Checksum:i1C8D7423F602F3E8
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti703 – 7031N → S in AAP35063. (PubMed:15203201)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti508 – 5081V → M.
Corresponds to variant rs11833801 [ dbSNP | Ensembl ].
VAR_049461
Natural varianti523 – 5231S → L.
Corresponds to variant rs11061318 [ dbSNP | Ensembl ].
VAR_049462

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 481481Missing in isoform 3. 1 PublicationVSP_012787Add
BLAST
Alternative sequencei1 – 314314Missing in isoform 2. 1 PublicationVSP_012788Add
BLAST
Alternative sequencei62 – 621G → GASRTHKLTVLPSRNATFVY SNDSAYSNLSATV in isoform 4. 1 PublicationVSP_053678
Alternative sequencei315 – 34127QTALN…WIALS → MEKGTELLVSPSQSGPGGDQ PLLVKHR in isoform 2. 1 PublicationVSP_012789Add
BLAST
Alternative sequencei482 – 49110LITVHLKHRL → MHRVCFLSFQ in isoform 3. 1 PublicationVSP_012790

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY532280 mRNA. Translation: AAS37682.1.
AY278561 mRNA. Translation: AAP35063.1.
EU523118 mRNA. Translation: ACB20802.1.
AK131538 mRNA. Translation: BAD18674.1.
AC073862 Genomic DNA. No translation available.
AC078925 Genomic DNA. No translation available.
AC126564 Genomic DNA. No translation available.
BC112307 mRNA. Translation: AAI12308.1.
BC112309 mRNA. Translation: AAI12310.1.
BC143775 mRNA. Translation: AAI43776.1.
AY255587 mRNA. Translation: AAO85099.1.
CCDSiCCDS9272.1. [Q6QNK2-1]
PIRiT47186.
RefSeqiNP_942122.2. NM_198827.3. [Q6QNK2-1]
UniGeneiHs.719239.

Genome annotation databases

EnsembliENST00000261654; ENSP00000261654; ENSG00000111452. [Q6QNK2-1]
ENST00000535015; ENSP00000444425; ENSG00000111452. [Q6QNK2-4]
ENST00000543617; ENSP00000438021; ENSG00000111452. [Q6QNK2-3]
GeneIDi283383.
KEGGihsa:283383.
UCSCiuc001uit.4. human. [Q6QNK2-1]
uc001uiv.1. human. [Q6QNK2-3]
uc010tbm.2. human.

Polymorphism databases

DMDMi59797935.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY532280 mRNA. Translation: AAS37682.1 .
AY278561 mRNA. Translation: AAP35063.1 .
EU523118 mRNA. Translation: ACB20802.1 .
AK131538 mRNA. Translation: BAD18674.1 .
AC073862 Genomic DNA. No translation available.
AC078925 Genomic DNA. No translation available.
AC126564 Genomic DNA. No translation available.
BC112307 mRNA. Translation: AAI12308.1 .
BC112309 mRNA. Translation: AAI12310.1 .
BC143775 mRNA. Translation: AAI43776.1 .
AY255587 mRNA. Translation: AAO85099.1 .
CCDSi CCDS9272.1. [Q6QNK2-1 ]
PIRi T47186.
RefSeqi NP_942122.2. NM_198827.3. [Q6QNK2-1 ]
UniGenei Hs.719239.

3D structure databases

ProteinModelPortali Q6QNK2.
SMRi Q6QNK2. Positions 569-815.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000261654.

Protein family/group databases

MEROPSi S63.024.
GPCRDBi Search...

PTM databases

PhosphoSitei Q6QNK2.

Polymorphism databases

DMDMi 59797935.

Proteomic databases

PaxDbi Q6QNK2.
PRIDEi Q6QNK2.

Protocols and materials databases

DNASUi 283383.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000261654 ; ENSP00000261654 ; ENSG00000111452 . [Q6QNK2-1 ]
ENST00000535015 ; ENSP00000444425 ; ENSG00000111452 . [Q6QNK2-4 ]
ENST00000543617 ; ENSP00000438021 ; ENSG00000111452 . [Q6QNK2-3 ]
GeneIDi 283383.
KEGGi hsa:283383.
UCSCi uc001uit.4. human. [Q6QNK2-1 ]
uc001uiv.1. human. [Q6QNK2-3 ]
uc010tbm.2. human.

Organism-specific databases

CTDi 283383.
GeneCardsi GC12P131438.
HGNCi HGNC:19893. GPR133.
HPAi HPA042395.
MIMi 613639. gene.
neXtProti NX_Q6QNK2.
PharmGKBi PA134923933.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG247313.
GeneTreei ENSGT00760000118787.
HOVERGENi HBG051779.
InParanoidi Q6QNK2.
KOi K08465.
OMAi DEIAMYF.
OrthoDBi EOG7966FS.
PhylomeDBi Q6QNK2.
TreeFami TF351999.

Miscellaneous databases

ChiTaRSi GPR133. human.
GenomeRNAii 283383.
NextBioi 35481285.
PROi Q6QNK2.
SOURCEi Search...

Gene expression databases

Bgeei Q6QNK2.
CleanExi HS_GPR133.
ExpressionAtlasi Q6QNK2. baseline and differential.
Genevestigatori Q6QNK2.

Family and domain databases

Gene3Di 2.60.120.200. 1 hit.
InterProi IPR013320. ConA-like_dom.
IPR017981. GPCR_2-like.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
[Graphical view ]
Pfami PF00002. 7tm_2. 1 hit.
PF01825. GPS. 1 hit.
[Graphical view ]
PRINTSi PR00249. GPCRSECRETIN.
SMARTi SM00303. GPS. 1 hit.
[Graphical view ]
SUPFAMi SSF49899. SSF49899. 1 hit.
PROSITEi PS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Bonner T.I., Nagle J.W., Kauffman D.
    Submitted (JAN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "The human and mouse repertoire of the adhesion family of G-protein-coupled receptors."
    Bjarnadottir T.K., Fredriksson R., Hoeglund P.J., Gloriam D.E., Lagerstroem M.C., Schioeth H.B.
    Genomics 84:23-33(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
  3. "Common splice variant of human GPR133 in brain."
    Bonner T.I., Sloger M., Nagle J.W., Kauffman D.
    Submitted (FEB-2008) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), ALTERNATIVE SPLICING.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  5. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4).
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 355-708.

Entry informationi

Entry nameiGP133_HUMAN
AccessioniPrimary (citable) accession number: Q6QNK2
Secondary accession number(s): B2CKK9
, B7ZLF7, Q2M1L3, Q6ZMQ1, Q7Z7M2, Q86SM4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 15, 2005
Last sequence update: July 5, 2004
Last modified: November 26, 2014
This is version 100 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3