SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6QNK2

- GP133_HUMAN

UniProt

Q6QNK2 - GP133_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Probable G-protein coupled receptor 133
Gene
GPR133, PGR25
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at transcript leveli

Functioni

Orphan receptor.

GO - Molecular functioni

  1. G-protein coupled receptor activity Source: GDB
Complete GO annotation...

GO - Biological processi

  1. G-protein coupled receptor signaling pathway Source: GDB
  2. neuropeptide signaling pathway Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Protein family/group databases

MEROPSiS63.024.

Names & Taxonomyi

Protein namesi
Recommended name:
Probable G-protein coupled receptor 133
Alternative name(s):
G-protein coupled receptor PGR25
Gene namesi
Name:GPR133
Synonyms:PGR25
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:19893. GPR133.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini26 – 570545Extracellular Reviewed prediction
Add
BLAST
Transmembranei571 – 59121Helical; Name=1; Reviewed prediction
Add
BLAST
Topological domaini592 – 60211Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei603 – 62321Helical; Name=2; Reviewed prediction
Add
BLAST
Topological domaini624 – 63310Extracellular Reviewed prediction
Transmembranei634 – 65421Helical; Name=3; Reviewed prediction
Add
BLAST
Topological domaini655 – 67420Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei675 – 69521Helical; Name=4; Reviewed prediction
Add
BLAST
Topological domaini696 – 71116Extracellular Reviewed prediction
Add
BLAST
Transmembranei712 – 73221Helical; Name=5; Reviewed prediction
Add
BLAST
Topological domaini733 – 76028Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei761 – 78121Helical; Name=6; Reviewed prediction
Add
BLAST
Topological domaini782 – 7843Extracellular Reviewed prediction
Transmembranei785 – 80521Helical; Name=7; Reviewed prediction
Add
BLAST
Topological domaini806 – 87469Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: GDB
  2. plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134923933.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2525 Reviewed prediction
Add
BLAST
Chaini26 – 874849Probable G-protein coupled receptor 133
PRO_0000012905Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi90 – 901N-linked (GlcNAc...) Reviewed prediction
Glycosylationi185 – 1851N-linked (GlcNAc...) Reviewed prediction
Glycosylationi282 – 2821N-linked (GlcNAc...) Reviewed prediction
Glycosylationi302 – 3021N-linked (GlcNAc...) Reviewed prediction
Glycosylationi319 – 3191N-linked (GlcNAc...) Reviewed prediction
Glycosylationi394 – 3941N-linked (GlcNAc...) Reviewed prediction
Glycosylationi476 – 4761N-linked (GlcNAc...) Reviewed prediction
Glycosylationi501 – 5011N-linked (GlcNAc...) Reviewed prediction
Glycosylationi533 – 5331N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ6QNK2.
PRIDEiQ6QNK2.

PTM databases

PhosphoSiteiQ6QNK2.

Expressioni

Gene expression databases

ArrayExpressiQ6QNK2.
BgeeiQ6QNK2.
CleanExiHS_GPR133.
GenevestigatoriQ6QNK2.

Organism-specific databases

HPAiHPA042395.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000261654.

Structurei

3D structure databases

ProteinModelPortaliQ6QNK2.
SMRiQ6QNK2. Positions 569-815.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini507 – 55650GPS
Add
BLAST

Sequence similaritiesi

Contains 1 GPS domain.

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG247313.
HOVERGENiHBG051779.
InParanoidiQ6QNK2.
KOiK08465.
OMAiDEIAMYF.
OrthoDBiEOG7966FS.
PhylomeDBiQ6QNK2.
TreeFamiTF351999.

Family and domain databases

Gene3Di2.60.120.200. 1 hit.
InterProiIPR008985. ConA-like_lec_gl_sf.
IPR013320. ConA-like_subgrp.
IPR017981. GPCR_2-like.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
[Graphical view]
PfamiPF00002. 7tm_2. 1 hit.
PF01825. GPS. 1 hit.
[Graphical view]
PRINTSiPR00249. GPCRSECRETIN.
SMARTiSM00303. GPS. 1 hit.
[Graphical view]
SUPFAMiSSF49899. SSF49899. 1 hit.
PROSITEiPS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6QNK2-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MEKLLRLCCW YSWLLLFYYN FQVRGVYSRS QDHPGFQVLA SASHYWPLEN    50
VDGIHELQDT TGDIVEGKVN KGIYLKEEKG VTLLYYGRYN SSCISKPEQC 100
GPEGVTFSFF WKTQGEQSRP IPSAYGGQVI SNGFKVCSSG GRGSVELYTR 150
DNSMTWEASF SPPGPYWTHV LFTWKSKEGL KVYVNGTLST SDPSGKVSRD 200
YGESNVNLVI GSEQDQAKCY ENGAFDEFII WERALTPDEI AMYFTAAIGK 250
HALLSSTLPS LFMTSTASPV MPTDAYHPII TNLTEERKTF QSPGVILSYL 300
QNVSLSLPSK SLSEQTALNL TKTFLKAVGE ILLLPGWIAL SEDSAVVLSL 350
IDTIDTVMGH VSSNLHGSTP QVTVEGSSAM AEFSVAKILP KTVNSSHYRF 400
PAHGQSFIQI PHEAFHRHAW STVVGLLYHS MHYYLNNIWP AHTKIAEAMH 450
HQDCLLFATS HLISLEVSPP PTLSQNLSGS PLITVHLKHR LTRKQHSEAT 500
NSSNRVFVYC AFLDFSSGEG VWSNHGCALT RGNLTYSVCR CTHLTNFAIL 550
MQVVPLELAR GHQVALSSIS YVGCSLSVLC LVATLVTFAV LSSVSTIRNQ 600
RYHIHANLSF AVLVAQVLLL ISFRLEPGTT PCQVMAVLLH YFFLSAFAWM 650
LVEGLHLYSM VIKVFGSEDS KHRYYYGMGW GFPLLICIIS LSFAMDSYGT 700
SNNCWLSLAS GAIWAFVAPA LFVIVVNIGI LIAVTRVISQ ISADNYKIHG 750
DPSAFKLTAK AVAVLLPILG TSWVFGVLAV NGCAVVFQYM FATLNSLQGL 800
FIFLFHCLLN SEVRAAFKHK TKVWSLTSSS ARTSNAKPFH SDLMNGTRPG 850
MASTKLSPWD KSSHSAHRVD LSAV 874
Length:874
Mass (Da):96,530
Last modified:July 5, 2004 - v1
Checksum:i8FC7C63D50F65E1B
GO
Isoform 2 (identifier: Q6QNK2-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-314: Missing.
     315-341: QTALNLTKTFLKAVGEILLLPGWIALS → MEKGTELLVSPSQSGPGGDQPLLVKHR

Note: No experimental confirmation available.

Show »
Length:560
Mass (Da):61,360
Checksum:i3191A83261A5078D
GO
Isoform 3 (identifier: Q6QNK2-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-481: Missing.
     482-491: LITVHLKHRL → MHRVCFLSFQ

Note: No experimental confirmation available.

Show »
Length:393
Mass (Da):43,210
Checksum:iD108A3060EA93E60
GO
Isoform 4 (identifier: Q6QNK2-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     62-62: G → GASRTHKLTVLPSRNATFVYSNDSAYSNLSATV

Note: No experimental confirmation available.

Show »
Length:906
Mass (Da):99,984
Checksum:i1C8D7423F602F3E8
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti508 – 5081V → M.
Corresponds to variant rs11833801 [ dbSNP | Ensembl ].
VAR_049461
Natural varianti523 – 5231S → L.
Corresponds to variant rs11061318 [ dbSNP | Ensembl ].
VAR_049462

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 481481Missing in isoform 3.
VSP_012787Add
BLAST
Alternative sequencei1 – 314314Missing in isoform 2.
VSP_012788Add
BLAST
Alternative sequencei62 – 621G → GASRTHKLTVLPSRNATFVY SNDSAYSNLSATV in isoform 4.
VSP_053678
Alternative sequencei315 – 34127QTALN…WIALS → MEKGTELLVSPSQSGPGGDQ PLLVKHR in isoform 2.
VSP_012789Add
BLAST
Alternative sequencei482 – 49110LITVHLKHRL → MHRVCFLSFQ in isoform 3.
VSP_012790

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti703 – 7031N → S in AAP35063. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY532280 mRNA. Translation: AAS37682.1.
AY278561 mRNA. Translation: AAP35063.1.
EU523118 mRNA. Translation: ACB20802.1.
AK131538 mRNA. Translation: BAD18674.1.
AC073862 Genomic DNA. No translation available.
AC078925 Genomic DNA. No translation available.
AC126564 Genomic DNA. No translation available.
BC112307 mRNA. Translation: AAI12308.1.
BC112309 mRNA. Translation: AAI12310.1.
BC143775 mRNA. Translation: AAI43776.1.
AY255587 mRNA. Translation: AAO85099.1.
CCDSiCCDS9272.1. [Q6QNK2-1]
PIRiT47186.
RefSeqiNP_942122.2. NM_198827.3. [Q6QNK2-1]
UniGeneiHs.719239.

Genome annotation databases

EnsembliENST00000261654; ENSP00000261654; ENSG00000111452. [Q6QNK2-1]
ENST00000376682; ENSP00000365872; ENSG00000111452. [Q6QNK2-2]
ENST00000535015; ENSP00000444425; ENSG00000111452. [Q6QNK2-4]
ENST00000543617; ENSP00000438021; ENSG00000111452. [Q6QNK2-3]
GeneIDi283383.
KEGGihsa:283383.
UCSCiuc001uit.4. human. [Q6QNK2-1]
uc001uiv.1. human. [Q6QNK2-3]
uc010tbm.2. human.

Polymorphism databases

DMDMi59797935.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY532280 mRNA. Translation: AAS37682.1 .
AY278561 mRNA. Translation: AAP35063.1 .
EU523118 mRNA. Translation: ACB20802.1 .
AK131538 mRNA. Translation: BAD18674.1 .
AC073862 Genomic DNA. No translation available.
AC078925 Genomic DNA. No translation available.
AC126564 Genomic DNA. No translation available.
BC112307 mRNA. Translation: AAI12308.1 .
BC112309 mRNA. Translation: AAI12310.1 .
BC143775 mRNA. Translation: AAI43776.1 .
AY255587 mRNA. Translation: AAO85099.1 .
CCDSi CCDS9272.1. [Q6QNK2-1 ]
PIRi T47186.
RefSeqi NP_942122.2. NM_198827.3. [Q6QNK2-1 ]
UniGenei Hs.719239.

3D structure databases

ProteinModelPortali Q6QNK2.
SMRi Q6QNK2. Positions 569-815.
ModBasei Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000261654.

Protein family/group databases

MEROPSi S63.024.
GPCRDBi Search...

PTM databases

PhosphoSitei Q6QNK2.

Polymorphism databases

DMDMi 59797935.

Proteomic databases

PaxDbi Q6QNK2.
PRIDEi Q6QNK2.

Protocols and materials databases

DNASUi 283383.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000261654 ; ENSP00000261654 ; ENSG00000111452 . [Q6QNK2-1 ]
ENST00000376682 ; ENSP00000365872 ; ENSG00000111452 . [Q6QNK2-2 ]
ENST00000535015 ; ENSP00000444425 ; ENSG00000111452 . [Q6QNK2-4 ]
ENST00000543617 ; ENSP00000438021 ; ENSG00000111452 . [Q6QNK2-3 ]
GeneIDi 283383.
KEGGi hsa:283383.
UCSCi uc001uit.4. human. [Q6QNK2-1 ]
uc001uiv.1. human. [Q6QNK2-3 ]
uc010tbm.2. human.

Organism-specific databases

CTDi 283383.
GeneCardsi GC12P131438.
HGNCi HGNC:19893. GPR133.
HPAi HPA042395.
MIMi 613639. gene.
neXtProti NX_Q6QNK2.
PharmGKBi PA134923933.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG247313.
HOVERGENi HBG051779.
InParanoidi Q6QNK2.
KOi K08465.
OMAi DEIAMYF.
OrthoDBi EOG7966FS.
PhylomeDBi Q6QNK2.
TreeFami TF351999.

Miscellaneous databases

GenomeRNAii 283383.
NextBioi 35481285.
PROi Q6QNK2.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q6QNK2.
Bgeei Q6QNK2.
CleanExi HS_GPR133.
Genevestigatori Q6QNK2.

Family and domain databases

Gene3Di 2.60.120.200. 1 hit.
InterProi IPR008985. ConA-like_lec_gl_sf.
IPR013320. ConA-like_subgrp.
IPR017981. GPCR_2-like.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
[Graphical view ]
Pfami PF00002. 7tm_2. 1 hit.
PF01825. GPS. 1 hit.
[Graphical view ]
PRINTSi PR00249. GPCRSECRETIN.
SMARTi SM00303. GPS. 1 hit.
[Graphical view ]
SUPFAMi SSF49899. SSF49899. 1 hit.
PROSITEi PS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Bonner T.I., Nagle J.W., Kauffman D.
    Submitted (JAN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "The human and mouse repertoire of the adhesion family of G-protein-coupled receptors."
    Bjarnadottir T.K., Fredriksson R., Hoeglund P.J., Gloriam D.E., Lagerstroem M.C., Schioeth H.B.
    Genomics 84:23-33(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
  3. "Common splice variant of human GPR133 in brain."
    Bonner T.I., Sloger M., Nagle J.W., Kauffman D.
    Submitted (FEB-2008) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), ALTERNATIVE SPLICING.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  5. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4).
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 355-708.

Entry informationi

Entry nameiGP133_HUMAN
AccessioniPrimary (citable) accession number: Q6QNK2
Secondary accession number(s): B2CKK9
, B7ZLF7, Q2M1L3, Q6ZMQ1, Q7Z7M2, Q86SM4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 15, 2005
Last sequence update: July 5, 2004
Last modified: July 9, 2014
This is version 97 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3
Error
SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

500 Internal Server Error

The server was not able to handle your request.

If this error occurs repeatedly, please contact us and indicate the page you were trying to access.