Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Coronin-6

Gene

CORO6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

SignaLinkiQ6QEF8.

Names & Taxonomyi

Protein namesi
Recommended name:
Coronin-6
Alternative name(s):
Coronin-like protein E
Short name:
Clipin-E
Gene namesi
Name:CORO6
ORF Names:PP1009, PP1782, PP1881
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:21356. CORO6.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134869901.

Polymorphism and mutation databases

BioMutaiCORO6.
DMDMi119369490.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 472472Coronin-6PRO_0000259596Add
BLAST

Proteomic databases

EPDiQ6QEF8.
MaxQBiQ6QEF8.
PaxDbiQ6QEF8.
PeptideAtlasiQ6QEF8.
PRIDEiQ6QEF8.

PTM databases

iPTMnetiQ6QEF8.
PhosphoSiteiQ6QEF8.

Expressioni

Gene expression databases

BgeeiQ6QEF8.
CleanExiHS_CORO6.
ExpressionAtlasiQ6QEF8. baseline and differential.
GenevisibleiQ6QEF8. HS.

Organism-specific databases

HPAiHPA021556.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
BLOC1S6Q9UL453EBI-10254194,EBI-465781

GO - Molecular functioni

Protein-protein interaction databases

BioGridi124374. 17 interactions.
IntActiQ6QEF8. 2 interactions.
STRINGi9606.ENSP00000344562.

Structurei

3D structure databases

ProteinModelPortaliQ6QEF8.
SMRiQ6QEF8. Positions 9-393.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati23 – 6442WD 1Add
BLAST
Repeati72 – 11140WD 2Add
BLAST
Repeati122 – 16140WD 3Add
BLAST
Repeati165 – 20440WD 4Add
BLAST
Repeati210 – 25142WD 5Add
BLAST
Repeati256 – 29641WD 6Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili430 – 46435Sequence analysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi54 – 574Poly-Gly

Sequence similaritiesi

Contains 6 WD repeats.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat, WD repeat

Phylogenomic databases

eggNOGiKOG0303. Eukaryota.
ENOG410XQAD. LUCA.
GeneTreeiENSGT00760000119195.
HOGENOMiHOG000166356.
HOVERGENiHBG059978.
InParanoidiQ6QEF8.
KOiK13886.
OMAiAPLSQHT.
OrthoDBiEOG7J70FB.
PhylomeDBiQ6QEF8.
TreeFamiTF314280.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
InterProiIPR024977. Apc4_WD40_dom.
IPR015505. Coronin.
IPR015048. DUF1899.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PANTHERiPTHR10856. PTHR10856. 1 hit.
PfamiPF12894. ANAPC4_WD40. 1 hit.
PF08953. DUF1899. 1 hit.
PF00400. WD40. 2 hits.
[Graphical view]
SMARTiSM01166. DUF1899. 1 hit.
SM00320. WD40. 3 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
PROSITEiPS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 3 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6QEF8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSRRVVRQSK FRHVFGQAAK ADQAYEDIRV SKVTWDSSFC AVNPKFLAII
60 70 80 90 100
VEAGGGGAFI VLPLAKTGRV DKNYPLVTGH TAPVLDIDWC PHNDNVIASA
110 120 130 140 150
SDDTTIMVWQ IPDYTPMRNI TEPIITLEGH SKRVGILSWH PTARNVLLSA
160 170 180 190 200
GGDNVIIIWN VGTGEVLLSL DDMHPDVIHS VCWNSNGSLL ATTCKDKTLR
210 220 230 240 250
IIDPRKGQVV AEQARPHEGA RPLRAVFTAD GKLLSTGFSR MSERQLALWD
260 270 280 290 300
PNNFEEPVAL QEMDTSNGVL LPFYDPDSSI VYLCGKGDSS IRYFEITDEP
310 320 330 340 350
PFVHYLNTFS SKEPQRGMGF MPKRGLDVSK CEIARFYKLH ERKCEPIIMT
360 370 380 390 400
VPRKSDLFQD DLYPDTPGPE PALEADEWLS GQDAEPVLIS LRDGYVPPKH
410 420 430 440 450
RELRVTKRNI LDVRPPSGPR RSQSASDAPL SQQHTLETLL EEIKALRERV
460 470
QAQEQRITAL ENMLCELVDG TD
Length:472
Mass (Da):52,762
Last modified:October 31, 2006 - v2
Checksum:iA49F939A4CD40A18
GO
Isoform 2 (identifier: Q6QEF8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-251: MSRRVVRQSK...SERQLALWDP → MCRGGGAMCA...GLVTPPVLGQ

Show »
Length:286
Mass (Da):31,789
Checksum:i0B808091879594CC
GO
Isoform 3 (identifier: Q6QEF8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-251: MSRRVVRQSK...SERQLALWDP → MCRGGGAMCA...GLVTPPVLGQ
     433-433: Missing.

Show »
Length:285
Mass (Da):31,661
Checksum:i4A849CE843A21AE3
GO
Isoform 4 (identifier: Q6QEF8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-251: MSRRVVRQSK...SERQLALWDP → MPSPWGWFAVTACGAQR
     433-433: Missing.

Show »
Length:237
Mass (Da):26,883
Checksum:iF4BFF89CB6D5AA06
GO
Isoform 5 (identifier: Q6QEF8-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     213-247: QARPHEGARPLRAVFTADGKLLSTGFSRMSERQLA → RFAAHEGMRPMRAVFTRQGHIFTTGFTRMSQRELG

Show »
Length:472
Mass (Da):52,988
Checksum:i0A83C72CC8C94283
GO

Sequence cautioni

The sequence AAG22467.1 differs from that shown. Reason: Erroneous translation. Wrong choice of frame.Curated
The sequence BAG53288.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti266 – 2661S → I in BAG53288 (PubMed:14702039).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 251251MSRRV…ALWDP → MCRGGGAMCAGEEERCAQGR GLQLWSLEVWGIGFGKARKR KGASGGPEVAREGGAGLVTP PVLGQ in isoform 2 and isoform 3. 3 PublicationsVSP_021484Add
BLAST
Alternative sequencei1 – 251251MSRRV…ALWDP → MPSPWGWFAVTACGAQR in isoform 4. 2 PublicationsVSP_021485Add
BLAST
Alternative sequencei213 – 24735QARPH…ERQLA → RFAAHEGMRPMRAVFTRQGH IFTTGFTRMSQRELG in isoform 5. 1 PublicationVSP_039874Add
BLAST
Alternative sequencei433 – 4331Missing in isoform 3 and isoform 4. 3 PublicationsVSP_021486

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF193039 mRNA. Translation: AAG22467.1. Sequence problems.
AF447884 mRNA. Translation: AAQ04659.1.
AF447885 mRNA. Translation: AAQ04660.1.
AY545070 mRNA. Translation: AAS48630.1.
AK027777 mRNA. Translation: BAB55360.1.
AK096431 mRNA. Translation: BAG53288.1. Different initiation.
AC104564 Genomic DNA. No translation available.
BC064514 mRNA. Translation: AAH64514.1.
CCDSiCCDS11252.2. [Q6QEF8-5]
RefSeqiNP_116243.2. NM_032854.3. [Q6QEF8-5]
XP_005258104.1. XM_005258047.2. [Q6QEF8-5]
XP_005258113.1. XM_005258056.3. [Q6QEF8-4]
UniGeneiHs.143046.

Genome annotation databases

EnsembliENST00000345068; ENSP00000344562; ENSG00000167549. [Q6QEF8-5]
ENST00000388767; ENSP00000373419; ENSG00000167549. [Q6QEF8-5]
GeneIDi84940.
KEGGihsa:84940.
UCSCiuc002hel.2. human. [Q6QEF8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF193039 mRNA. Translation: AAG22467.1. Sequence problems.
AF447884 mRNA. Translation: AAQ04659.1.
AF447885 mRNA. Translation: AAQ04660.1.
AY545070 mRNA. Translation: AAS48630.1.
AK027777 mRNA. Translation: BAB55360.1.
AK096431 mRNA. Translation: BAG53288.1. Different initiation.
AC104564 Genomic DNA. No translation available.
BC064514 mRNA. Translation: AAH64514.1.
CCDSiCCDS11252.2. [Q6QEF8-5]
RefSeqiNP_116243.2. NM_032854.3. [Q6QEF8-5]
XP_005258104.1. XM_005258047.2. [Q6QEF8-5]
XP_005258113.1. XM_005258056.3. [Q6QEF8-4]
UniGeneiHs.143046.

3D structure databases

ProteinModelPortaliQ6QEF8.
SMRiQ6QEF8. Positions 9-393.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124374. 17 interactions.
IntActiQ6QEF8. 2 interactions.
STRINGi9606.ENSP00000344562.

PTM databases

iPTMnetiQ6QEF8.
PhosphoSiteiQ6QEF8.

Polymorphism and mutation databases

BioMutaiCORO6.
DMDMi119369490.

Proteomic databases

EPDiQ6QEF8.
MaxQBiQ6QEF8.
PaxDbiQ6QEF8.
PeptideAtlasiQ6QEF8.
PRIDEiQ6QEF8.

Protocols and materials databases

DNASUi84940.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000345068; ENSP00000344562; ENSG00000167549. [Q6QEF8-5]
ENST00000388767; ENSP00000373419; ENSG00000167549. [Q6QEF8-5]
GeneIDi84940.
KEGGihsa:84940.
UCSCiuc002hel.2. human. [Q6QEF8-1]

Organism-specific databases

CTDi84940.
GeneCardsiCORO6.
H-InvDBHIX0013675.
HGNCiHGNC:21356. CORO6.
HPAiHPA021556.
neXtProtiNX_Q6QEF8.
PharmGKBiPA134869901.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0303. Eukaryota.
ENOG410XQAD. LUCA.
GeneTreeiENSGT00760000119195.
HOGENOMiHOG000166356.
HOVERGENiHBG059978.
InParanoidiQ6QEF8.
KOiK13886.
OMAiAPLSQHT.
OrthoDBiEOG7J70FB.
PhylomeDBiQ6QEF8.
TreeFamiTF314280.

Enzyme and pathway databases

SignaLinkiQ6QEF8.

Miscellaneous databases

ChiTaRSiCORO6. human.
GenomeRNAii84940.
PROiQ6QEF8.

Gene expression databases

BgeeiQ6QEF8.
CleanExiHS_CORO6.
ExpressionAtlasiQ6QEF8. baseline and differential.
GenevisibleiQ6QEF8. HS.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
InterProiIPR024977. Apc4_WD40_dom.
IPR015505. Coronin.
IPR015048. DUF1899.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PANTHERiPTHR10856. PTHR10856. 1 hit.
PfamiPF12894. ANAPC4_WD40. 1 hit.
PF08953. DUF1899. 1 hit.
PF00400. WD40. 2 hits.
[Graphical view]
SMARTiSM01166. DUF1899. 1 hit.
SM00320. WD40. 3 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
PROSITEiPS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 3 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Large-scale cDNA transfection screening for genes related to cancer development and progression."
    Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X.
    , Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S., Gu J.
    Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
  2. Shen C., Wang C., Li H., Zhou G., Ke R., Zhong G., Lin L., Yang S.
    Submitted (FEB-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 32-472 (ISOFORM 5).
    Tissue: Placenta and Tongue.
  4. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Lymph.

Entry informationi

Entry nameiCORO6_HUMAN
AccessioniPrimary (citable) accession number: Q6QEF8
Secondary accession number(s): B3KU26
, Q71MF3, Q8WYH7, Q96K02
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: October 31, 2006
Last modified: July 6, 2016
This is version 104 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.