Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q6Q6R5 (CRIP3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 84. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Cysteine-rich protein 3

Short name=CRP-3
Alternative name(s):
Chromosome 6 LIM domain only protein
Short name=h6LIMo
Gene names
Name:CRIP3
Synonyms:CRP3
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length217 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Subcellular location

Cytoplasm By similarity.

Tissue specificity

Expressed in most tissues, but not in skeletal muscle. Ref.1

Sequence similarities

Contains 2 LIM zinc-binding domains.

Ontologies

Keywords
   Cellular componentCytoplasm
   Coding sequence diversityAlternative splicing
   DomainLIM domain
Repeat
   LigandMetal-binding
Zinc
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processT cell proliferation

Inferred from electronic annotation. Source: Ensembl

   Cellular_componentcytoplasm

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionzinc ion binding

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q6Q6R5-1)

Also known as: C;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q6Q6R5-2)

Also known as: B;

The sequence of this isoform differs from the canonical sequence as follows:
     205-217: HGLWVCVDNFPCG → V
Isoform 3 (identifier: Q6Q6R5-3)

Also known as: A;

The sequence of this isoform differs from the canonical sequence as follows:
     186-217: GQPHPRHWDGMYMPEVWHVHGLWVCVDNFPCG → VNIGDVGCYIYDPVKIKFK
Isoform 4 (identifier: Q6Q6R5-4)

Also known as: D;

The sequence of this isoform differs from the canonical sequence as follows:
     166-217: HDGVPYCHVPCYGYLFGPKGGQPHPRHWDGMYMPEVWHVHGLWVCVDNFPCG → V

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 217217Cysteine-rich protein 3
PRO_0000225638

Regions

Domain3 – 6462LIM zinc-binding 1
Domain122 – 18362LIM zinc-binding 2

Natural variations

Alternative sequence166 – 21752HDGVP…NFPCG → V in isoform 4.
VSP_017391
Alternative sequence186 – 21732GQPHP…NFPCG → VNIGDVGCYIYDPVKIKFK in isoform 3.
VSP_017393
Alternative sequence205 – 21713HGLWV…NFPCG → V in isoform 2.
VSP_017392

Experimental info

Sequence conflict1411G → S in AAS66887. Ref.1
Sequence conflict1411G → S in AAS66888. Ref.1
Sequence conflict1411G → S in AAS66889. Ref.1
Sequence conflict1411G → S in AAS66890. Ref.1
Sequence conflict1481C → R in AAS66887. Ref.1
Sequence conflict1481C → R in AAS66888. Ref.1
Sequence conflict1481C → R in AAS66889. Ref.1
Sequence conflict1481C → R in AAS66890. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (C) [UniParc].

Last modified March 7, 2006. Version 2.
Checksum: B8FC618E29AE244F

FASTA21724,088
        10         20         30         40         50         60 
MSWTCPRCQQ PVFFAEKVSS LGKNWHRFCL KCERCHSILS PGGHAEHNGR PYCHKPCYGA 

        70         80         90        100        110        120 
LFGPRGVNIG GVGSYLYNPP TPSPGCTTPL SPSSFSPPRP RTGLPQGKKS PPHMKTFTGE 

       130        140        150        160        170        180 
TSLCPGCGEP VYFAEKVMSL GRNWHRPCLR CQRCHKTLTA GSHAEHDGVP YCHVPCYGYL 

       190        200        210 
FGPKGGQPHP RHWDGMYMPE VWHVHGLWVC VDNFPCG 

« Hide

Isoform 2 (B) [UniParc].

Checksum: CB6EC36C400C72C4
Show »

FASTA20522,758
Isoform 3 (A) [UniParc].

Checksum: 5E037096ACA17061
Show »

FASTA20422,471
Isoform 4 (D) [UniParc].

Checksum: D71B84378DC7488D
Show »

FASTA16618,225

References

« Hide 'large scale' references
[1]"The human and mouse orthologous LIM-only proteins respectively encoded in chromosome 6 and 17 show a different expression pattern."
Casrouge A., Veitia R., Kirchner J., Bevan M.J., Kanellopoulos J.
Microbes Infect. 6:1063-1072(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), TISSUE SPECIFICITY.
[2]"The DNA sequence and analysis of human chromosome 6."
Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. expand/collapse author list , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY555741 mRNA. Translation: AAS66887.1.
AY555742 mRNA. Translation: AAS66888.1.
AY555743 mRNA. Translation: AAS66889.1.
AY555744 mRNA. Translation: AAS66890.1.
AL583834 Genomic DNA. Translation: CAI14469.1.
AL583834 Genomic DNA. Translation: CAM20552.1.
RefSeqNP_996805.2. NM_206922.2.
XP_005249160.1. XM_005249103.1.
UniGeneHs.653165.

3D structure databases

ProteinModelPortalQ6Q6R5.
SMRQ6Q6R5. Positions 1-211.
ModBaseSearch...
MobiDBSearch...

PTM databases

PhosphoSiteQ6Q6R5.

Polymorphism databases

DMDM92087061.

Proteomic databases

PaxDbQ6Q6R5.
PRIDEQ6Q6R5.

Protocols and materials databases

DNASU401262.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000274990; ENSP00000274990; ENSG00000146215. [Q6Q6R5-1]
ENST00000372569; ENSP00000361650; ENSG00000146215. [Q6Q6R5-3]
GeneID401262.
KEGGhsa:401262.
UCSCuc003ouu.1. human. [Q6Q6R5-3]
uc010jyn.2. human. [Q6Q6R5-1]

Organism-specific databases

CTD401262.
GeneCardsGC06M043267.
HGNCHGNC:17751. CRIP3.
HPAHPA036198.
neXtProtNX_Q6Q6R5.
PharmGKBPA134929489.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG246818.
HOGENOMHOG000111234.
HOVERGENHBG051143.
InParanoidQ6Q6R5.
OMAGCEEPVY.
OrthoDBEOG7CK39M.
PhylomeDBQ6Q6R5.
TreeFamTF313758.

Gene expression databases

ArrayExpressQ6Q6R5.
BgeeQ6Q6R5.
CleanExHS_CRIP3.
GenevestigatorQ6Q6R5.

Family and domain databases

Gene3D2.10.110.10. 2 hits.
InterProIPR001781. Znf_LIM.
[Graphical view]
PfamPF00412. LIM. 2 hits.
[Graphical view]
SMARTSM00132. LIM. 2 hits.
[Graphical view]
PROSITEPS00478. LIM_DOMAIN_1. 2 hits.
PS50023. LIM_DOMAIN_2. 2 hits.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi401262.
NextBio106676.
PROQ6Q6R5.

Entry information

Entry nameCRIP3_HUMAN
AccessionPrimary (citable) accession number: Q6Q6R5
Secondary accession number(s): A2A436 expand/collapse secondary AC list , Q5T043, Q6Q6R4, Q6Q6R6, Q6Q6R7
Entry history
Integrated into UniProtKB/Swiss-Prot: March 7, 2006
Last sequence update: March 7, 2006
Last modified: April 16, 2014
This is version 84 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human chromosome 6

Human chromosome 6: entries, gene names and cross-references to MIM