SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6Q6R5

- CRIP3_HUMAN

UniProt

Q6Q6R5 - CRIP3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Cysteine-rich protein 3
Gene
CRIP3, CRP3
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

  1. zinc ion binding Source: InterPro

GO - Biological processi

  1. T cell proliferation Source: Ensembl
Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Cysteine-rich protein 3
Short name:
CRP-3
Alternative name(s):
Chromosome 6 LIM domain only protein
Short name:
h6LIMo
Gene namesi
Name:CRIP3
Synonyms:CRP3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 6

Organism-specific databases

HGNCiHGNC:17751. CRIP3.

Subcellular locationi

Cytoplasm By similarity

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134929489.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 217217Cysteine-rich protein 3
PRO_0000225638Add
BLAST

Proteomic databases

PaxDbiQ6Q6R5.
PRIDEiQ6Q6R5.

PTM databases

PhosphoSiteiQ6Q6R5.

Expressioni

Tissue specificityi

Expressed in most tissues, but not in skeletal muscle.1 Publication

Gene expression databases

ArrayExpressiQ6Q6R5.
BgeeiQ6Q6R5.
CleanExiHS_CRIP3.
GenevestigatoriQ6Q6R5.

Organism-specific databases

HPAiHPA036198.

Structurei

3D structure databases

ProteinModelPortaliQ6Q6R5.
SMRiQ6Q6R5. Positions 1-211.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini3 – 6462LIM zinc-binding 1
Add
BLAST
Domaini122 – 18362LIM zinc-binding 2
Add
BLAST

Sequence similaritiesi

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

eggNOGiNOG246818.
HOGENOMiHOG000111234.
HOVERGENiHBG051143.
InParanoidiQ6Q6R5.
OMAiMIPRPRI.
OrthoDBiEOG7CK39M.
PhylomeDBiQ6Q6R5.
TreeFamiTF313758.

Family and domain databases

Gene3Di2.10.110.10. 2 hits.
InterProiIPR001781. Znf_LIM.
[Graphical view]
PfamiPF00412. LIM. 2 hits.
[Graphical view]
SMARTiSM00132. LIM. 2 hits.
[Graphical view]
PROSITEiPS00478. LIM_DOMAIN_1. 2 hits.
PS50023. LIM_DOMAIN_2. 2 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6Q6R5-1) [UniParc]FASTAAdd to Basket

Also known as: C

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSWTCPRCQQ PVFFAEKVSS LGKNWHRFCL KCERCHSILS PGGHAEHNGR    50
PYCHKPCYGA LFGPRGVNIG GVGSYLYNPP TPSPGCTTPL SPSSFSPPRP 100
RTGLPQGKKS PPHMKTFTGE TSLCPGCGEP VYFAEKVMSL GRNWHRPCLR 150
CQRCHKTLTA GSHAEHDGVP YCHVPCYGYL FGPKGGQPHP RHWDGMYMPE 200
VWHVHGLWVC VDNFPCG 217
Length:217
Mass (Da):24,088
Last modified:March 7, 2006 - v2
Checksum:iB8FC618E29AE244F
GO
Isoform 2 (identifier: Q6Q6R5-2) [UniParc]FASTAAdd to Basket

Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     205-217: HGLWVCVDNFPCG → V

Show »
Length:205
Mass (Da):22,758
Checksum:iCB6EC36C400C72C4
GO
Isoform 3 (identifier: Q6Q6R5-3) [UniParc]FASTAAdd to Basket

Also known as: A

The sequence of this isoform differs from the canonical sequence as follows:
     186-217: GQPHPRHWDGMYMPEVWHVHGLWVCVDNFPCG → VNIGDVGCYIYDPVKIKFK

Show »
Length:204
Mass (Da):22,471
Checksum:i5E037096ACA17061
GO
Isoform 4 (identifier: Q6Q6R5-4) [UniParc]FASTAAdd to Basket

Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     166-217: HDGVPYCHVPCYGYLFGPKGGQPHPRHWDGMYMPEVWHVHGLWVCVDNFPCG → V

Show »
Length:166
Mass (Da):18,225
Checksum:iD71B84378DC7488D
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei166 – 21752HDGVP…NFPCG → V in isoform 4.
VSP_017391Add
BLAST
Alternative sequencei186 – 21732GQPHP…NFPCG → VNIGDVGCYIYDPVKIKFK in isoform 3.
VSP_017393Add
BLAST
Alternative sequencei205 – 21713HGLWV…NFPCG → V in isoform 2.
VSP_017392Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti141 – 1411G → S in AAS66887. 1 Publication
Sequence conflicti141 – 1411G → S in AAS66888. 1 Publication
Sequence conflicti141 – 1411G → S in AAS66889. 1 Publication
Sequence conflicti141 – 1411G → S in AAS66890. 1 Publication
Sequence conflicti148 – 1481C → R in AAS66887. 1 Publication
Sequence conflicti148 – 1481C → R in AAS66888. 1 Publication
Sequence conflicti148 – 1481C → R in AAS66889. 1 Publication
Sequence conflicti148 – 1481C → R in AAS66890. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY555741 mRNA. Translation: AAS66887.1.
AY555742 mRNA. Translation: AAS66888.1.
AY555743 mRNA. Translation: AAS66889.1.
AY555744 mRNA. Translation: AAS66890.1.
AL583834 Genomic DNA. Translation: CAI14469.1.
AL583834 Genomic DNA. Translation: CAM20552.1.
CCDSiCCDS4894.2. [Q6Q6R5-3]
RefSeqiNP_996805.2. NM_206922.2. [Q6Q6R5-3]
XP_005249160.1. XM_005249103.1. [Q6Q6R5-1]
UniGeneiHs.653165.

Genome annotation databases

EnsembliENST00000274990; ENSP00000274990; ENSG00000146215. [Q6Q6R5-1]
ENST00000372569; ENSP00000361650; ENSG00000146215. [Q6Q6R5-3]
GeneIDi401262.
KEGGihsa:401262.
UCSCiuc003ouu.1. human. [Q6Q6R5-3]
uc010jyn.2. human. [Q6Q6R5-1]

Polymorphism databases

DMDMi92087061.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY555741 mRNA. Translation: AAS66887.1 .
AY555742 mRNA. Translation: AAS66888.1 .
AY555743 mRNA. Translation: AAS66889.1 .
AY555744 mRNA. Translation: AAS66890.1 .
AL583834 Genomic DNA. Translation: CAI14469.1 .
AL583834 Genomic DNA. Translation: CAM20552.1 .
CCDSi CCDS4894.2. [Q6Q6R5-3 ]
RefSeqi NP_996805.2. NM_206922.2. [Q6Q6R5-3 ]
XP_005249160.1. XM_005249103.1. [Q6Q6R5-1 ]
UniGenei Hs.653165.

3D structure databases

ProteinModelPortali Q6Q6R5.
SMRi Q6Q6R5. Positions 1-211.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei Q6Q6R5.

Polymorphism databases

DMDMi 92087061.

Proteomic databases

PaxDbi Q6Q6R5.
PRIDEi Q6Q6R5.

Protocols and materials databases

DNASUi 401262.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000274990 ; ENSP00000274990 ; ENSG00000146215 . [Q6Q6R5-1 ]
ENST00000372569 ; ENSP00000361650 ; ENSG00000146215 . [Q6Q6R5-3 ]
GeneIDi 401262.
KEGGi hsa:401262.
UCSCi uc003ouu.1. human. [Q6Q6R5-3 ]
uc010jyn.2. human. [Q6Q6R5-1 ]

Organism-specific databases

CTDi 401262.
GeneCardsi GC06M043267.
HGNCi HGNC:17751. CRIP3.
HPAi HPA036198.
neXtProti NX_Q6Q6R5.
PharmGKBi PA134929489.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG246818.
HOGENOMi HOG000111234.
HOVERGENi HBG051143.
InParanoidi Q6Q6R5.
OMAi MIPRPRI.
OrthoDBi EOG7CK39M.
PhylomeDBi Q6Q6R5.
TreeFami TF313758.

Miscellaneous databases

GenomeRNAii 401262.
NextBioi 106676.
PROi Q6Q6R5.

Gene expression databases

ArrayExpressi Q6Q6R5.
Bgeei Q6Q6R5.
CleanExi HS_CRIP3.
Genevestigatori Q6Q6R5.

Family and domain databases

Gene3Di 2.10.110.10. 2 hits.
InterProi IPR001781. Znf_LIM.
[Graphical view ]
Pfami PF00412. LIM. 2 hits.
[Graphical view ]
SMARTi SM00132. LIM. 2 hits.
[Graphical view ]
PROSITEi PS00478. LIM_DOMAIN_1. 2 hits.
PS50023. LIM_DOMAIN_2. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The human and mouse orthologous LIM-only proteins respectively encoded in chromosome 6 and 17 show a different expression pattern."
    Casrouge A., Veitia R., Kirchner J., Bevan M.J., Kanellopoulos J.
    Microbes Infect. 6:1063-1072(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), TISSUE SPECIFICITY.
  2. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

Entry informationi

Entry nameiCRIP3_HUMAN
AccessioniPrimary (citable) accession number: Q6Q6R5
Secondary accession number(s): A2A436
, Q5T043, Q6Q6R4, Q6Q6R6, Q6Q6R7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 7, 2006
Last sequence update: March 7, 2006
Last modified: July 9, 2014
This is version 86 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi