Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6Q6R5

- CRIP3_HUMAN

UniProt

Q6Q6R5 - CRIP3_HUMAN

Protein

Cysteine-rich protein 3

Gene

CRIP3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 87 (01 Oct 2014)
      Sequence version 2 (07 Mar 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. zinc ion binding Source: InterPro

    GO - Biological processi

    1. T cell proliferation Source: Ensembl

    Keywords - Ligandi

    Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cysteine-rich protein 3
    Short name:
    CRP-3
    Alternative name(s):
    Chromosome 6 LIM domain only protein
    Short name:
    h6LIMo
    Gene namesi
    Name:CRIP3
    Synonyms:CRP3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 6

    Organism-specific databases

    HGNCiHGNC:17751. CRIP3.

    Subcellular locationi

    Cytoplasm By similarity

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134929489.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 217217Cysteine-rich protein 3PRO_0000225638Add
    BLAST

    Proteomic databases

    PaxDbiQ6Q6R5.
    PRIDEiQ6Q6R5.

    PTM databases

    PhosphoSiteiQ6Q6R5.

    Expressioni

    Tissue specificityi

    Expressed in most tissues, but not in skeletal muscle.1 Publication

    Gene expression databases

    ArrayExpressiQ6Q6R5.
    BgeeiQ6Q6R5.
    CleanExiHS_CRIP3.
    GenevestigatoriQ6Q6R5.

    Organism-specific databases

    HPAiHPA036198.

    Structurei

    3D structure databases

    ProteinModelPortaliQ6Q6R5.
    SMRiQ6Q6R5. Positions 1-211.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini3 – 6462LIM zinc-binding 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini122 – 18362LIM zinc-binding 2PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 2 LIM zinc-binding domains.PROSITE-ProRule annotation

    Keywords - Domaini

    LIM domain, Repeat

    Phylogenomic databases

    eggNOGiNOG246818.
    HOGENOMiHOG000111234.
    HOVERGENiHBG051143.
    InParanoidiQ6Q6R5.
    OMAiMIPRPRI.
    OrthoDBiEOG7CK39M.
    PhylomeDBiQ6Q6R5.
    TreeFamiTF313758.

    Family and domain databases

    Gene3Di2.10.110.10. 2 hits.
    InterProiIPR001781. Znf_LIM.
    [Graphical view]
    PfamiPF00412. LIM. 2 hits.
    [Graphical view]
    SMARTiSM00132. LIM. 2 hits.
    [Graphical view]
    PROSITEiPS00478. LIM_DOMAIN_1. 2 hits.
    PS50023. LIM_DOMAIN_2. 2 hits.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6Q6R5-1) [UniParc]FASTAAdd to Basket

    Also known as: C

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSWTCPRCQQ PVFFAEKVSS LGKNWHRFCL KCERCHSILS PGGHAEHNGR    50
    PYCHKPCYGA LFGPRGVNIG GVGSYLYNPP TPSPGCTTPL SPSSFSPPRP 100
    RTGLPQGKKS PPHMKTFTGE TSLCPGCGEP VYFAEKVMSL GRNWHRPCLR 150
    CQRCHKTLTA GSHAEHDGVP YCHVPCYGYL FGPKGGQPHP RHWDGMYMPE 200
    VWHVHGLWVC VDNFPCG 217
    Length:217
    Mass (Da):24,088
    Last modified:March 7, 2006 - v2
    Checksum:iB8FC618E29AE244F
    GO
    Isoform 2 (identifier: Q6Q6R5-2) [UniParc]FASTAAdd to Basket

    Also known as: B

    The sequence of this isoform differs from the canonical sequence as follows:
         205-217: HGLWVCVDNFPCG → V

    Show »
    Length:205
    Mass (Da):22,758
    Checksum:iCB6EC36C400C72C4
    GO
    Isoform 3 (identifier: Q6Q6R5-3) [UniParc]FASTAAdd to Basket

    Also known as: A

    The sequence of this isoform differs from the canonical sequence as follows:
         186-217: GQPHPRHWDGMYMPEVWHVHGLWVCVDNFPCG → VNIGDVGCYIYDPVKIKFK

    Show »
    Length:204
    Mass (Da):22,471
    Checksum:i5E037096ACA17061
    GO
    Isoform 4 (identifier: Q6Q6R5-4) [UniParc]FASTAAdd to Basket

    Also known as: D

    The sequence of this isoform differs from the canonical sequence as follows:
         166-217: HDGVPYCHVPCYGYLFGPKGGQPHPRHWDGMYMPEVWHVHGLWVCVDNFPCG → V

    Show »
    Length:166
    Mass (Da):18,225
    Checksum:iD71B84378DC7488D
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti141 – 1411G → S in AAS66887. (PubMed:15380775)Curated
    Sequence conflicti141 – 1411G → S in AAS66888. (PubMed:15380775)Curated
    Sequence conflicti141 – 1411G → S in AAS66889. (PubMed:15380775)Curated
    Sequence conflicti141 – 1411G → S in AAS66890. (PubMed:15380775)Curated
    Sequence conflicti148 – 1481C → R in AAS66887. (PubMed:15380775)Curated
    Sequence conflicti148 – 1481C → R in AAS66888. (PubMed:15380775)Curated
    Sequence conflicti148 – 1481C → R in AAS66889. (PubMed:15380775)Curated
    Sequence conflicti148 – 1481C → R in AAS66890. (PubMed:15380775)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei166 – 21752HDGVP…NFPCG → V in isoform 4. 1 PublicationVSP_017391Add
    BLAST
    Alternative sequencei186 – 21732GQPHP…NFPCG → VNIGDVGCYIYDPVKIKFK in isoform 3. 1 PublicationVSP_017393Add
    BLAST
    Alternative sequencei205 – 21713HGLWV…NFPCG → V in isoform 2. 1 PublicationVSP_017392Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY555741 mRNA. Translation: AAS66887.1.
    AY555742 mRNA. Translation: AAS66888.1.
    AY555743 mRNA. Translation: AAS66889.1.
    AY555744 mRNA. Translation: AAS66890.1.
    AL583834 Genomic DNA. Translation: CAI14469.1.
    AL583834 Genomic DNA. Translation: CAM20552.1.
    CCDSiCCDS4894.2. [Q6Q6R5-3]
    RefSeqiNP_996805.2. NM_206922.2. [Q6Q6R5-3]
    XP_005249160.1. XM_005249103.1. [Q6Q6R5-1]
    UniGeneiHs.653165.

    Genome annotation databases

    EnsembliENST00000274990; ENSP00000274990; ENSG00000146215. [Q6Q6R5-1]
    ENST00000372569; ENSP00000361650; ENSG00000146215. [Q6Q6R5-3]
    GeneIDi401262.
    KEGGihsa:401262.
    UCSCiuc003ouu.1. human. [Q6Q6R5-3]
    uc010jyn.2. human. [Q6Q6R5-1]

    Polymorphism databases

    DMDMi92087061.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY555741 mRNA. Translation: AAS66887.1 .
    AY555742 mRNA. Translation: AAS66888.1 .
    AY555743 mRNA. Translation: AAS66889.1 .
    AY555744 mRNA. Translation: AAS66890.1 .
    AL583834 Genomic DNA. Translation: CAI14469.1 .
    AL583834 Genomic DNA. Translation: CAM20552.1 .
    CCDSi CCDS4894.2. [Q6Q6R5-3 ]
    RefSeqi NP_996805.2. NM_206922.2. [Q6Q6R5-3 ]
    XP_005249160.1. XM_005249103.1. [Q6Q6R5-1 ]
    UniGenei Hs.653165.

    3D structure databases

    ProteinModelPortali Q6Q6R5.
    SMRi Q6Q6R5. Positions 1-211.
    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei Q6Q6R5.

    Polymorphism databases

    DMDMi 92087061.

    Proteomic databases

    PaxDbi Q6Q6R5.
    PRIDEi Q6Q6R5.

    Protocols and materials databases

    DNASUi 401262.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000274990 ; ENSP00000274990 ; ENSG00000146215 . [Q6Q6R5-1 ]
    ENST00000372569 ; ENSP00000361650 ; ENSG00000146215 . [Q6Q6R5-3 ]
    GeneIDi 401262.
    KEGGi hsa:401262.
    UCSCi uc003ouu.1. human. [Q6Q6R5-3 ]
    uc010jyn.2. human. [Q6Q6R5-1 ]

    Organism-specific databases

    CTDi 401262.
    GeneCardsi GC06M043267.
    HGNCi HGNC:17751. CRIP3.
    HPAi HPA036198.
    neXtProti NX_Q6Q6R5.
    PharmGKBi PA134929489.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG246818.
    HOGENOMi HOG000111234.
    HOVERGENi HBG051143.
    InParanoidi Q6Q6R5.
    OMAi MIPRPRI.
    OrthoDBi EOG7CK39M.
    PhylomeDBi Q6Q6R5.
    TreeFami TF313758.

    Miscellaneous databases

    GenomeRNAii 401262.
    NextBioi 106676.
    PROi Q6Q6R5.

    Gene expression databases

    ArrayExpressi Q6Q6R5.
    Bgeei Q6Q6R5.
    CleanExi HS_CRIP3.
    Genevestigatori Q6Q6R5.

    Family and domain databases

    Gene3Di 2.10.110.10. 2 hits.
    InterProi IPR001781. Znf_LIM.
    [Graphical view ]
    Pfami PF00412. LIM. 2 hits.
    [Graphical view ]
    SMARTi SM00132. LIM. 2 hits.
    [Graphical view ]
    PROSITEi PS00478. LIM_DOMAIN_1. 2 hits.
    PS50023. LIM_DOMAIN_2. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The human and mouse orthologous LIM-only proteins respectively encoded in chromosome 6 and 17 show a different expression pattern."
      Casrouge A., Veitia R., Kirchner J., Bevan M.J., Kanellopoulos J.
      Microbes Infect. 6:1063-1072(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), TISSUE SPECIFICITY.
    2. "The DNA sequence and analysis of human chromosome 6."
      Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
      , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
      Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

    Entry informationi

    Entry nameiCRIP3_HUMAN
    AccessioniPrimary (citable) accession number: Q6Q6R5
    Secondary accession number(s): A2A436
    , Q5T043, Q6Q6R4, Q6Q6R6, Q6Q6R7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 7, 2006
    Last sequence update: March 7, 2006
    Last modified: October 1, 2014
    This is version 87 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 6
      Human chromosome 6: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3