Q6Q6R5 (CRIP3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 77.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Cysteine-rich protein 3 Short name=CRP-3 Alternative name(s): Chromosome 6 LIM domain only protein Short name=h6LIMo | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 217 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Subcellular location | Cytoplasm By similarity. |
| Tissue specificity | Expressed in most tissues, but not in skeletal muscle. Ref.1 |
| Sequence similarities | Contains 2 LIM zinc-binding domains. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Domain | LIM domain Repeat |
| Ligand | Metal-binding Zinc |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | T cell proliferation Inferred from electronic annotation. Source: Compara |
| Cellular_component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | zinc ion binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6Q6R5-1) Also known as: C; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6Q6R5-2) Also known as: B; The sequence of this isoform differs from the canonical sequence as follows: 205-217: HGLWVCVDNFPCG → V | ||||||
| Isoform 3 (identifier: Q6Q6R5-3) Also known as: A; The sequence of this isoform differs from the canonical sequence as follows: 186-217: GQPHPRHWDGMYMPEVWHVHGLWVCVDNFPCG → VNIGDVGCYIYDPVKIKFK | ||||||
| Isoform 4 (identifier: Q6Q6R5-4) Also known as: D; The sequence of this isoform differs from the canonical sequence as follows: 166-217: HDGVPYCHVPCYGYLFGPKGGQPHPRHWDGMYMPEVWHVHGLWVCVDNFPCG → V |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 217 | 217 | Cysteine-rich protein 3 | PRO_0000225638 | |||||
Regions | |||||||||
| Domain | 3 – 64 | 62 | LIM zinc-binding 1 | ||||||
| Domain | 122 – 183 | 62 | LIM zinc-binding 2 | ||||||
Natural variations | |||||||||
| Alternative sequence | 166 – 217 | 52 | HDGVP…NFPCG → V in isoform 4. | VSP_017391 | |||||
| Alternative sequence | 186 – 217 | 32 | GQPHP…NFPCG → VNIGDVGCYIYDPVKIKFK in isoform 3. | VSP_017393 | |||||
| Alternative sequence | 205 – 217 | 13 | HGLWV…NFPCG → V in isoform 2. | VSP_017392 | |||||
Experimental info | |||||||||
| Sequence conflict | 141 | 1 | G → S in AAS66887. Ref.1 | ||||||
| Sequence conflict | 141 | 1 | G → S in AAS66888. Ref.1 | ||||||
| Sequence conflict | 141 | 1 | G → S in AAS66889. Ref.1 | ||||||
| Sequence conflict | 141 | 1 | G → S in AAS66890. Ref.1 | ||||||
| Sequence conflict | 148 | 1 | C → R in AAS66887. Ref.1 | ||||||
| Sequence conflict | 148 | 1 | C → R in AAS66888. Ref.1 | ||||||
| Sequence conflict | 148 | 1 | C → R in AAS66889. Ref.1 | ||||||
| Sequence conflict | 148 | 1 | C → R in AAS66890. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The human and mouse orthologous LIM-only proteins respectively encoded in chromosome 6 and 17 show a different expression pattern." Casrouge A., Veitia R., Kirchner J., Bevan M.J., Kanellopoulos J. Microbes Infect. 6:1063-1072(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), TISSUE SPECIFICITY. |
| [2] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY555741 mRNA. Translation: AAS66887.1. AY555742 mRNA. Translation: AAS66888.1. AY555743 mRNA. Translation: AAS66889.1. AY555744 mRNA. Translation: AAS66890.1. AL583834 Genomic DNA. Translation: CAI14469.1. AL583834 Genomic DNA. Translation: CAM20552.1. |
| IPI | IPI00410146. IPI00645306. IPI00735865. IPI00738893. |
| RefSeq | NP_996805.2. NM_206922.2. |
| UniGene | Hs.653165. |
3D structure databases | |
| ProteinModelPortal | Q6Q6R5. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q6Q6R5. |
Polymorphism databases | |
| DMDM | 92087061. |
Proteomic databases | |
| PaxDb | Q6Q6R5. |
| PRIDE | Q6Q6R5. |
Protocols and materials databases | |
| DNASU | 401262. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000274990; ENSP00000274990; ENSG00000146215. ENST00000372569; ENSP00000361650; ENSG00000146215. |
| GeneID | 401262. |
| KEGG | hsa:401262. |
| UCSC | uc003ouu.1. human. uc010jyn.2. human. |
Organism-specific databases | |
| CTD | 401262. |
| GeneCards | GC06M043267. |
| HGNC | HGNC:17751. CRIP3. |
| HPA | HPA036198. |
| neXtProt | NX_Q6Q6R5. |
| PharmGKB | PA134929489. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG246818. |
| HOGENOM | HOG000111234. |
| HOVERGEN | HBG051143. |
| InParanoid | Q6Q6R5. |
| OMA | CEHCHSV. |
| PhylomeDB | Q6Q6R5. |
Gene expression databases | |
| ArrayExpress | Q6Q6R5. |
| Bgee | Q6Q6R5. |
| CleanEx | HS_CRIP3. |
| Genevestigator | Q6Q6R5. |
| GermOnline | ENSG00000146215. Homo sapiens. |
Family and domain databases | |
| Gene3D | 2.10.110.10. 2 hits. |
| InterPro | IPR001781. Znf_LIM. [Graphical view] |
| Pfam | PF00412. LIM. 2 hits. [Graphical view] |
| SMART | SM00132. LIM. 2 hits. [Graphical view] |
| PROSITE | PS00478. LIM_DOMAIN_1. 2 hits. PS50023. LIM_DOMAIN_2. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 401262. |
| NextBio | 106676. |
Entry information
| Entry name | CRIP3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6Q6R5 Secondary accession number(s): A2A436 Q6Q6R7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with
