Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cysteine-rich protein 3

Gene

CRIP3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Cysteine-rich protein 3
Short name:
CRP-3
Alternative name(s):
Chromosome 6 LIM domain only protein
Short name:
h6LIMo
Gene namesi
Name:CRIP3
Synonyms:CRP3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:17751. CRIP3.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi401262.
OpenTargetsiENSG00000146215.
PharmGKBiPA134929489.

Polymorphism and mutation databases

BioMutaiCRIP3.
DMDMi92087061.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002256381 – 217Cysteine-rich protein 3Add BLAST217

Proteomic databases

PaxDbiQ6Q6R5.
PeptideAtlasiQ6Q6R5.
PRIDEiQ6Q6R5.

PTM databases

iPTMnetiQ6Q6R5.
PhosphoSitePlusiQ6Q6R5.

Expressioni

Tissue specificityi

Expressed in most tissues, but not in skeletal muscle.1 Publication

Gene expression databases

BgeeiENSG00000146215.
CleanExiHS_CRIP3.
ExpressionAtlasiQ6Q6R5. baseline and differential.
GenevisibleiQ6Q6R5. HS.

Organism-specific databases

HPAiHPA036198.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000361650.

Structurei

3D structure databases

ProteinModelPortaliQ6Q6R5.
SMRiQ6Q6R5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini3 – 64LIM zinc-binding 1PROSITE-ProRule annotationAdd BLAST62
Domaini122 – 183LIM zinc-binding 2PROSITE-ProRule annotationAdd BLAST62

Sequence similaritiesi

Contains 2 LIM zinc-binding domains.PROSITE-ProRule annotation

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

eggNOGiENOG410KDR9. Eukaryota.
ENOG4110HIQ. LUCA.
GeneTreeiENSGT00550000074548.
HOGENOMiHOG000111234.
HOVERGENiHBG051143.
InParanoidiQ6Q6R5.
OMAiIYDPVEI.
OrthoDBiEOG091G11RX.
PhylomeDBiQ6Q6R5.
TreeFamiTF313758.

Family and domain databases

Gene3Di2.10.110.10. 2 hits.
InterProiIPR001781. Znf_LIM.
[Graphical view]
PfamiPF00412. LIM. 2 hits.
[Graphical view]
SMARTiSM00132. LIM. 2 hits.
[Graphical view]
PROSITEiPS00478. LIM_DOMAIN_1. 2 hits.
PS50023. LIM_DOMAIN_2. 2 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6Q6R5-1) [UniParc]FASTAAdd to basket
Also known as: C

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSWTCPRCQQ PVFFAEKVSS LGKNWHRFCL KCERCHSILS PGGHAEHNGR
60 70 80 90 100
PYCHKPCYGA LFGPRGVNIG GVGSYLYNPP TPSPGCTTPL SPSSFSPPRP
110 120 130 140 150
RTGLPQGKKS PPHMKTFTGE TSLCPGCGEP VYFAEKVMSL GRNWHRPCLR
160 170 180 190 200
CQRCHKTLTA GSHAEHDGVP YCHVPCYGYL FGPKGGQPHP RHWDGMYMPE
210
VWHVHGLWVC VDNFPCG
Length:217
Mass (Da):24,088
Last modified:March 7, 2006 - v2
Checksum:iB8FC618E29AE244F
GO
Isoform 2 (identifier: Q6Q6R5-2) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     205-217: HGLWVCVDNFPCG → V

Show »
Length:205
Mass (Da):22,758
Checksum:iCB6EC36C400C72C4
GO
Isoform 3 (identifier: Q6Q6R5-3) [UniParc]FASTAAdd to basket
Also known as: A

The sequence of this isoform differs from the canonical sequence as follows:
     186-217: GQPHPRHWDGMYMPEVWHVHGLWVCVDNFPCG → VNIGDVGCYIYDPVKIKFK

Show »
Length:204
Mass (Da):22,471
Checksum:i5E037096ACA17061
GO
Isoform 4 (identifier: Q6Q6R5-4) [UniParc]FASTAAdd to basket
Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     166-217: HDGVPYCHVPCYGYLFGPKGGQPHPRHWDGMYMPEVWHVHGLWVCVDNFPCG → V

Show »
Length:166
Mass (Da):18,225
Checksum:iD71B84378DC7488D
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti141G → S in AAS66887 (PubMed:15380775).Curated1
Sequence conflicti141G → S in AAS66888 (PubMed:15380775).Curated1
Sequence conflicti141G → S in AAS66889 (PubMed:15380775).Curated1
Sequence conflicti141G → S in AAS66890 (PubMed:15380775).Curated1
Sequence conflicti148C → R in AAS66887 (PubMed:15380775).Curated1
Sequence conflicti148C → R in AAS66888 (PubMed:15380775).Curated1
Sequence conflicti148C → R in AAS66889 (PubMed:15380775).Curated1
Sequence conflicti148C → R in AAS66890 (PubMed:15380775).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_017391166 – 217HDGVP…NFPCG → V in isoform 4. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_017393186 – 217GQPHP…NFPCG → VNIGDVGCYIYDPVKIKFK in isoform 3. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_017392205 – 217HGLWV…NFPCG → V in isoform 2. 1 PublicationAdd BLAST13

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY555741 mRNA. Translation: AAS66887.1.
AY555742 mRNA. Translation: AAS66888.1.
AY555743 mRNA. Translation: AAS66889.1.
AY555744 mRNA. Translation: AAS66890.1.
AL583834 Genomic DNA. Translation: CAI14469.1.
AL583834 Genomic DNA. Translation: CAM20552.1.
CCDSiCCDS4894.2. [Q6Q6R5-3]
RefSeqiNP_996805.2. NM_206922.2. [Q6Q6R5-3]
XP_005249160.1. XM_005249103.3. [Q6Q6R5-1]
XP_011512911.1. XM_011514609.2. [Q6Q6R5-4]
UniGeneiHs.653165.

Genome annotation databases

EnsembliENST00000274990; ENSP00000274990; ENSG00000146215. [Q6Q6R5-1]
ENST00000372569; ENSP00000361650; ENSG00000146215. [Q6Q6R5-3]
GeneIDi401262.
KEGGihsa:401262.
UCSCiuc003ouu.2. human. [Q6Q6R5-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY555741 mRNA. Translation: AAS66887.1.
AY555742 mRNA. Translation: AAS66888.1.
AY555743 mRNA. Translation: AAS66889.1.
AY555744 mRNA. Translation: AAS66890.1.
AL583834 Genomic DNA. Translation: CAI14469.1.
AL583834 Genomic DNA. Translation: CAM20552.1.
CCDSiCCDS4894.2. [Q6Q6R5-3]
RefSeqiNP_996805.2. NM_206922.2. [Q6Q6R5-3]
XP_005249160.1. XM_005249103.3. [Q6Q6R5-1]
XP_011512911.1. XM_011514609.2. [Q6Q6R5-4]
UniGeneiHs.653165.

3D structure databases

ProteinModelPortaliQ6Q6R5.
SMRiQ6Q6R5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000361650.

PTM databases

iPTMnetiQ6Q6R5.
PhosphoSitePlusiQ6Q6R5.

Polymorphism and mutation databases

BioMutaiCRIP3.
DMDMi92087061.

Proteomic databases

PaxDbiQ6Q6R5.
PeptideAtlasiQ6Q6R5.
PRIDEiQ6Q6R5.

Protocols and materials databases

DNASUi401262.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000274990; ENSP00000274990; ENSG00000146215. [Q6Q6R5-1]
ENST00000372569; ENSP00000361650; ENSG00000146215. [Q6Q6R5-3]
GeneIDi401262.
KEGGihsa:401262.
UCSCiuc003ouu.2. human. [Q6Q6R5-1]

Organism-specific databases

CTDi401262.
DisGeNETi401262.
GeneCardsiCRIP3.
HGNCiHGNC:17751. CRIP3.
HPAiHPA036198.
neXtProtiNX_Q6Q6R5.
OpenTargetsiENSG00000146215.
PharmGKBiPA134929489.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410KDR9. Eukaryota.
ENOG4110HIQ. LUCA.
GeneTreeiENSGT00550000074548.
HOGENOMiHOG000111234.
HOVERGENiHBG051143.
InParanoidiQ6Q6R5.
OMAiIYDPVEI.
OrthoDBiEOG091G11RX.
PhylomeDBiQ6Q6R5.
TreeFamiTF313758.

Miscellaneous databases

ChiTaRSiCRIP3. human.
GenomeRNAii401262.
PROiQ6Q6R5.

Gene expression databases

BgeeiENSG00000146215.
CleanExiHS_CRIP3.
ExpressionAtlasiQ6Q6R5. baseline and differential.
GenevisibleiQ6Q6R5. HS.

Family and domain databases

Gene3Di2.10.110.10. 2 hits.
InterProiIPR001781. Znf_LIM.
[Graphical view]
PfamiPF00412. LIM. 2 hits.
[Graphical view]
SMARTiSM00132. LIM. 2 hits.
[Graphical view]
PROSITEiPS00478. LIM_DOMAIN_1. 2 hits.
PS50023. LIM_DOMAIN_2. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCRIP3_HUMAN
AccessioniPrimary (citable) accession number: Q6Q6R5
Secondary accession number(s): A2A436
, Q5T043, Q6Q6R4, Q6Q6R6, Q6Q6R7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 7, 2006
Last sequence update: March 7, 2006
Last modified: November 2, 2016
This is version 104 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.