Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

ATPase family AAA domain-containing protein 2

Gene

ATAD2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May be a transcriptional coactivator of the nuclear receptor ESR1 required to induce the expression of a subset of estradiol target genes, such as CCND1, MYC and E2F1. May play a role in the recruitment or occupancy of CREBBP at some ESR1 target gene promoters. May be required for histone hyperacetylation. Involved in the estrogen-induced cell proliferation and cell cycle progression of breast cancer cells.1 Publication

Catalytic activityi

ATP + H2O = ADP + phosphate.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi467 – 474ATPSequence analysis8

GO - Molecular functioni

  • ATPase activity Source: UniProtKB
  • ATP binding Source: UniProtKB-KW
  • chromatin binding Source: GO_Central
  • histone binding Source: GO_Central

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Activator, Hydrolase

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciZFISH:HS08153-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
ATPase family AAA domain-containing protein 2 (EC:3.6.1.3)
Alternative name(s):
AAA nuclear coregulator cancer-associated protein
Short name:
ANCCA
Gene namesi
Name:ATAD2
ORF Names:L16, PRO2000
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

HGNCiHGNC:30123. ATAD2.

Subcellular locationi

GO - Cellular componenti

  • extracellular exosome Source: UniProtKB
  • nucleoplasm Source: HPA
  • nucleus Source: GO_Central
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi473K → T: Reduces the ability to mediate estradiol-dependent induction of CCND1 and E2F1; when associated with Q-532. 1 Publication1
Mutagenesisi532E → Q: Reduces the ability to mediate estradiol-dependent induction of CCND1 and E2F1; when associated with T-473. 1 Publication1

Organism-specific databases

DisGeNETi29028.
OpenTargetsiENSG00000156802.
PharmGKBiPA134895566.

Chemistry databases

ChEMBLiCHEMBL2150837.
GuidetoPHARMACOLOGYi2719.

Polymorphism and mutation databases

BioMutaiATAD2.
DMDMi74762365.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000847961 – 1390ATPase family AAA domain-containing protein 2Add BLAST1390

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei60PhosphoserineCombined sources1
Modified residuei61PhosphoserineCombined sources1
Modified residuei165PhosphoserineCombined sources1
Modified residuei170PhosphoserineCombined sources1
Modified residuei327PhosphoserineCombined sources1
Modified residuei337PhosphoserineCombined sources1
Modified residuei342PhosphoserineCombined sources1
Modified residuei410PhosphoserineCombined sources1
Modified residuei746PhosphoserineCombined sources1
Modified residuei751PhosphoserineCombined sources1
Modified residuei1139PhosphoserineCombined sources1
Modified residuei1149PhosphothreonineCombined sources1
Modified residuei1152PhosphothreonineCombined sources1
Modified residuei1176PhosphothreonineCombined sources1
Modified residuei1200PhosphoserineCombined sources1
Modified residuei1233PhosphoserineCombined sources1
Modified residuei1235PhosphoserineCombined sources1
Modified residuei1243PhosphoserineCombined sources1
Modified residuei1302PhosphoserineCombined sources1
Modified residuei1323PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ6PL18.
MaxQBiQ6PL18.
PaxDbiQ6PL18.
PeptideAtlasiQ6PL18.
PRIDEiQ6PL18.

PTM databases

iPTMnetiQ6PL18.
PhosphoSitePlusiQ6PL18.

Expressioni

Tissue specificityi

Highly expressed in estrogen receptor positive breast tumors and in osteosarcoma tumors.3 Publications

Inductioni

Up-regulated in breast, uterus, colon, ovary, and stomach tumors. Induced in breast cancer cells overexpressing NCOA3 or treated with estrogen. Down-regulated in 5-fluorouracil-resistant derivatives of the colon cancer cell line HCT 116.3 Publications

Gene expression databases

BgeeiENSG00000156802.
CleanExiHS_ATAD2.
ExpressionAtlasiQ6PL18. baseline and differential.
GenevisibleiQ6PL18. HS.

Organism-specific databases

HPAiCAB056158.
HPA019860.
HPA029424.

Interactioni

Subunit structurei

Interacts with ESR1 and NCOA3 and these interactions are enhanced by estradiol. Interacts with acetylated lysine residues on histone H1.4, H2A, H2B and H3 (in vitro).2 Publications

GO - Molecular functioni

Protein-protein interaction databases

BioGridi118827. 21 interactors.
DIPiDIP-46197N.
IntActiQ6PL18. 8 interactors.
STRINGi9606.ENSP00000287394.

Chemistry databases

BindingDBiQ6PL18.

Structurei

Secondary structure

11390
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi981 – 1001Combined sources21
Helixi1004 – 1009Combined sources6
Turni1015 – 1017Combined sources3
Helixi1021 – 1024Combined sources4
Helixi1031 – 1039Combined sources9
Helixi1046 – 1063Combined sources18
Beta strandi1066 – 1068Combined sources3
Helixi1069 – 1092Combined sources24
Helixi1095 – 1106Combined sources12

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3DAIX-ray1.95A981-1108[»]
4QSPX-ray1.60A981-1108[»]
4QSQX-ray1.80A981-1108[»]
4QSRX-ray2.00A981-1108[»]
4QSSX-ray2.00A981-1108[»]
4QSTX-ray2.05A981-1108[»]
4QSUX-ray1.90A981-1108[»]
4QSVX-ray1.90A981-1108[»]
4QSWX-ray1.80A981-1108[»]
4QSXX-ray1.93A981-1108[»]
4QUTX-ray1.70A981-1108[»]
4QUUX-ray1.80A981-1108[»]
4TT2X-ray2.50A981-1108[»]
4TT4X-ray2.70A/B981-1108[»]
4TT6X-ray2.00A981-1108[»]
4TTEX-ray1.80A981-1108[»]
4TU4X-ray1.73A981-1108[»]
4TU6X-ray2.27A/B/C/D981-1108[»]
4TYLX-ray1.85A981-1108[»]
4TZ2X-ray1.70A981-1108[»]
4TZ8X-ray2.15A981-1108[»]
5A5NX-ray1.95A981-1108[»]
5A5OX-ray2.04A981-1108[»]
5A5PX-ray2.03A981-1108[»]
5A5QX-ray1.97A981-1108[»]
5A5RX-ray2.01A981-1108[»]
5A81X-ray2.03A981-1108[»]
5A82X-ray1.86A981-1108[»]
5A83X-ray2.09A981-1108[»]
5LJ0X-ray1.82A981-1108[»]
ProteinModelPortaliQ6PL18.
SMRiQ6PL18.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ6PL18.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1001 – 1071BromoPROSITE-ProRule annotationAdd BLAST71

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili970 – 994Sequence analysisAdd BLAST25
Coiled coili1086 – 1112Sequence analysisAdd BLAST27

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi250 – 285Asp-richAdd BLAST36
Compositional biasi357 – 366Poly-Ser10

Sequence similaritiesi

Belongs to the AAA ATPase family.Curated
Contains 1 bromo domain.PROSITE-ProRule annotation

Keywords - Domaini

Bromodomain, Coiled coil

Phylogenomic databases

eggNOGiKOG0732. Eukaryota.
COG0464. LUCA.
GeneTreeiENSGT00550000074694.
HOVERGENiHBG080873.
InParanoidiQ6PL18.
OMAiMPKQNST.
OrthoDBiEOG091G0152.
PhylomeDBiQ6PL18.
TreeFamiTF314783.

Family and domain databases

Gene3Di1.20.920.10. 1 hit.
1.25.10.10. 1 hit.
3.40.50.300. 2 hits.
InterProiIPR003593. AAA+_ATPase.
IPR031252. ANCCA.
IPR011989. ARM-like.
IPR003959. ATPase_AAA_core.
IPR003960. ATPase_AAA_CS.
IPR001487. Bromodomain.
IPR027417. P-loop_NTPase.
[Graphical view]
PANTHERiPTHR23069:SF4. PTHR23069:SF4. 1 hit.
PfamiPF00004. AAA. 1 hit.
PF00439. Bromodomain. 1 hit.
[Graphical view]
PRINTSiPR00503. BROMODOMAIN.
SMARTiSM00382. AAA. 1 hit.
SM00297. BROMO. 1 hit.
[Graphical view]
SUPFAMiSSF47370. SSF47370. 1 hit.
SSF52540. SSF52540. 3 hits.
PROSITEiPS00674. AAA. 1 hit.
PS50014. BROMODOMAIN_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6PL18-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVVLRSSLEL HNHSAASATG SLDLSSDFLS LEHIGRRRLR SAGAAQKKPA
60 70 80 90 100
ATTAKAGDGS SVKEVETYHR TRALRSLRKD AQNSSDSSFE KNVEITEQLA
110 120 130 140 150
NGRHFTRQLA RQQADKKKEE HREDKVIPVT RSLRARNIVQ STEHLHEDNG
160 170 180 190 200
DVEVRRSCRI RSRYSGVNQS MLFDKLITNT AEAVLQKMDD MKKMRRQRMR
210 220 230 240 250
ELEDLGVFNE TEESNLNMYT RGKQKDIQRT DEETTDNQEG SVESSEEGED
260 270 280 290 300
QEHEDDGEDE DDEDDDDDDD DDDDDDDEDD EDEEDGEEEN QKRYYLRQRK
310 320 330 340 350
ATVYYQAPLE KPRHQRKPNI FYSGPASPAR PRYRLSSAGP RSPYCKRMNR
360 370 380 390 400
RRHAIHSSDS TSSSSSEDEQ HFERRRKRSR NRAINRCLPL NFRKDELKGI
410 420 430 440 450
YKDRMKIGAS LADVDPMQLD SSVRFDSVGG LSNHIAALKE MVVFPLLYPE
460 470 480 490 500
VFEKFKIQPP RGCLFYGPPG TGKTLVARAL ANECSQGDKR VAFFMRKGAD
510 520 530 540 550
CLSKWVGESE RQLRLLFDQA YQMRPSIIFF DEIDGLAPVR SSRQDQIHSS
560 570 580 590 600
IVSTLLALMD GLDSRGEIVV IGATNRLDSI DPALRRPGRF DREFLFSLPD
610 620 630 640 650
KEARKEILKI HTRDWNPKPL DTFLEELAEN CVGYCGADIK SICAEAALCA
660 670 680 690 700
LRRRYPQIYT TSEKLQLDLS SINISAKDFE VAMQKMIPAS QRAVTSPGQA
710 720 730 740 750
LSTVVKPLLQ NTVDKILEAL QRVFPHAEFR TNKTLDSDIS CPLLESDLAY
760 770 780 790 800
SDDDVPSVYE NGLSQKSSHK AKDNFNFLHL NRNACYQPMS FRPRILIVGE
810 820 830 840 850
PGFGQGSHLA PAVIHALEKF TVYTLDIPVL FGVSTTSPEE TCAQVIREAK
860 870 880 890 900
RTAPSIVYVP HIHVWWEIVG PTLKATFTTL LQNIPSFAPV LLLATSDKPH
910 920 930 940 950
SALPEEVQEL FIRDYGEIFN VQLPDKEERT KFFEDLILKQ AAKPPISKKK
960 970 980 990 1000
AVLQALEVLP VAPPPEPRSL TAEEVKRLEE QEEDTFRELR IFLRNVTHRL
1010 1020 1030 1040 1050
AIDKRFRVFT KPVDPDEVPD YVTVIKQPMD LSSVISKIDL HKYLTVKDYL
1060 1070 1080 1090 1100
RDIDLICSNA LEYNPDRDPG DRLIRHRACA LRDTAYAIIK EELDEDFEQL
1110 1120 1130 1140 1150
CEEIQESRKK RGCSSSKYAP SYYHVMPKQN STLVGDKRSD PEQNEKLKTP
1160 1170 1180 1190 1200
STPVACSTPA QLKRKIRKKS NWYLGTIKKR RKISQAKDDS QNAIDHKIES
1210 1220 1230 1240 1250
DTEETQDTSV DHNETGNTGE SSVEENEKQQ NASESKLELR NNSNTCNIEN
1260 1270 1280 1290 1300
ELEDSRKTTA CTELRDKIAC NGDASSSQII HISDENEGKE MCVLRMTRAR
1310 1320 1330 1340 1350
RSQVEQQQLI TVEKALAILS QPTPSLVVDH ERLKNLLKTV VKKSQNYNIF
1360 1370 1380 1390
QLENLYAVIS QCIYRHRKDH DKTSLIQKME QEVENFSCSR
Length:1,390
Mass (Da):158,554
Last modified:July 5, 2004 - v1
Checksum:iF43B30C77BB0F4BA
GO
Isoform 2 (identifier: Q6PL18-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-170: Missing.
     551-582: IVSTLLALMDGLDSRGEIVVIGATNRLDSIDP → YGWIGQQRGNCGHWCYEQARFYRSCFTKAWSL
     583-1390: Missing.

Note: No experimental confirmation available. Dubious isoform. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:412
Mass (Da):47,986
Checksum:i24E5F0638207B64A
GO

Sequence cautioni

The sequence AAF22032 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAH10686 differs from that shown. Contaminating sequence. Sequence of unknown origin in the N-terminal part (676-679).Curated
The sequence AAH19909 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0476251280I → T.Corresponds to variant rs3758122dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0156331 – 170Missing in isoform 2. 1 PublicationAdd BLAST170
Alternative sequenceiVSP_015634551 – 582IVSTL…DSIDP → YGWIGQQRGNCGHWCYEQAR FYRSCFTKAWSL in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_015635583 – 1390Missing in isoform 2. 1 PublicationAdd BLAST808

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY598335 mRNA. Translation: AAT06746.1.
CR749832 mRNA. Translation: CAH18688.1.
AL833653 mRNA. Translation: CAH56229.1.
BC010686 mRNA. Translation: AAH10686.1. Sequence problems.
BC019909 mRNA. Translation: AAH19909.1. Different initiation.
BC113656 mRNA. Translation: AAI13657.1.
AK097133 mRNA. Translation: BAC04959.1.
AF118088 mRNA. Translation: AAF22032.1. Different initiation.
CCDSiCCDS6343.1. [Q6PL18-1]
RefSeqiNP_054828.2. NM_014109.3. [Q6PL18-1]
UniGeneiHs.370834.

Genome annotation databases

EnsembliENST00000287394; ENSP00000287394; ENSG00000156802. [Q6PL18-1]
GeneIDi29028.
KEGGihsa:29028.
UCSCiuc003yqh.5. human. [Q6PL18-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY598335 mRNA. Translation: AAT06746.1.
CR749832 mRNA. Translation: CAH18688.1.
AL833653 mRNA. Translation: CAH56229.1.
BC010686 mRNA. Translation: AAH10686.1. Sequence problems.
BC019909 mRNA. Translation: AAH19909.1. Different initiation.
BC113656 mRNA. Translation: AAI13657.1.
AK097133 mRNA. Translation: BAC04959.1.
AF118088 mRNA. Translation: AAF22032.1. Different initiation.
CCDSiCCDS6343.1. [Q6PL18-1]
RefSeqiNP_054828.2. NM_014109.3. [Q6PL18-1]
UniGeneiHs.370834.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3DAIX-ray1.95A981-1108[»]
4QSPX-ray1.60A981-1108[»]
4QSQX-ray1.80A981-1108[»]
4QSRX-ray2.00A981-1108[»]
4QSSX-ray2.00A981-1108[»]
4QSTX-ray2.05A981-1108[»]
4QSUX-ray1.90A981-1108[»]
4QSVX-ray1.90A981-1108[»]
4QSWX-ray1.80A981-1108[»]
4QSXX-ray1.93A981-1108[»]
4QUTX-ray1.70A981-1108[»]
4QUUX-ray1.80A981-1108[»]
4TT2X-ray2.50A981-1108[»]
4TT4X-ray2.70A/B981-1108[»]
4TT6X-ray2.00A981-1108[»]
4TTEX-ray1.80A981-1108[»]
4TU4X-ray1.73A981-1108[»]
4TU6X-ray2.27A/B/C/D981-1108[»]
4TYLX-ray1.85A981-1108[»]
4TZ2X-ray1.70A981-1108[»]
4TZ8X-ray2.15A981-1108[»]
5A5NX-ray1.95A981-1108[»]
5A5OX-ray2.04A981-1108[»]
5A5PX-ray2.03A981-1108[»]
5A5QX-ray1.97A981-1108[»]
5A5RX-ray2.01A981-1108[»]
5A81X-ray2.03A981-1108[»]
5A82X-ray1.86A981-1108[»]
5A83X-ray2.09A981-1108[»]
5LJ0X-ray1.82A981-1108[»]
ProteinModelPortaliQ6PL18.
SMRiQ6PL18.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi118827. 21 interactors.
DIPiDIP-46197N.
IntActiQ6PL18. 8 interactors.
STRINGi9606.ENSP00000287394.

Chemistry databases

BindingDBiQ6PL18.
ChEMBLiCHEMBL2150837.
GuidetoPHARMACOLOGYi2719.

PTM databases

iPTMnetiQ6PL18.
PhosphoSitePlusiQ6PL18.

Polymorphism and mutation databases

BioMutaiATAD2.
DMDMi74762365.

Proteomic databases

EPDiQ6PL18.
MaxQBiQ6PL18.
PaxDbiQ6PL18.
PeptideAtlasiQ6PL18.
PRIDEiQ6PL18.

Protocols and materials databases

DNASUi29028.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000287394; ENSP00000287394; ENSG00000156802. [Q6PL18-1]
GeneIDi29028.
KEGGihsa:29028.
UCSCiuc003yqh.5. human. [Q6PL18-1]

Organism-specific databases

CTDi29028.
DisGeNETi29028.
GeneCardsiATAD2.
H-InvDBHIX0007764.
HGNCiHGNC:30123. ATAD2.
HPAiCAB056158.
HPA019860.
HPA029424.
MIMi611941. gene.
neXtProtiNX_Q6PL18.
OpenTargetsiENSG00000156802.
PharmGKBiPA134895566.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0732. Eukaryota.
COG0464. LUCA.
GeneTreeiENSGT00550000074694.
HOVERGENiHBG080873.
InParanoidiQ6PL18.
OMAiMPKQNST.
OrthoDBiEOG091G0152.
PhylomeDBiQ6PL18.
TreeFamiTF314783.

Enzyme and pathway databases

BioCyciZFISH:HS08153-MONOMER.

Miscellaneous databases

ChiTaRSiATAD2. human.
EvolutionaryTraceiQ6PL18.
GenomeRNAii29028.
PROiQ6PL18.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000156802.
CleanExiHS_ATAD2.
ExpressionAtlasiQ6PL18. baseline and differential.
GenevisibleiQ6PL18. HS.

Family and domain databases

Gene3Di1.20.920.10. 1 hit.
1.25.10.10. 1 hit.
3.40.50.300. 2 hits.
InterProiIPR003593. AAA+_ATPase.
IPR031252. ANCCA.
IPR011989. ARM-like.
IPR003959. ATPase_AAA_core.
IPR003960. ATPase_AAA_CS.
IPR001487. Bromodomain.
IPR027417. P-loop_NTPase.
[Graphical view]
PANTHERiPTHR23069:SF4. PTHR23069:SF4. 1 hit.
PfamiPF00004. AAA. 1 hit.
PF00439. Bromodomain. 1 hit.
[Graphical view]
PRINTSiPR00503. BROMODOMAIN.
SMARTiSM00382. AAA. 1 hit.
SM00297. BROMO. 1 hit.
[Graphical view]
SUPFAMiSSF47370. SSF47370. 1 hit.
SSF52540. SSF52540. 3 hits.
PROSITEiPS00674. AAA. 1 hit.
PS50014. BROMODOMAIN_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiATAD2_HUMAN
AccessioniPrimary (citable) accession number: Q6PL18
Secondary accession number(s): Q14CR1
, Q658P2, Q68CQ0, Q6PJV6, Q8N890, Q9UHS5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 13, 2005
Last sequence update: July 5, 2004
Last modified: November 30, 2016
This is version 125 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.