Q6PL18 (ATAD2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 78.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: ATPase family AAA domain-containing protein 2 EC=3.6.1.3 Alternative name(s): AAA nuclear coregulator cancer-associated protein Short name=ANCCA | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1390 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May be a transcriptional coactivator of the nuclear receptor ESR1 required to induce the expression of a subset of estradiol target genes, such as CCND1, MYC and E2F1. May play a role in the recruitment or occupancy of CREBBP at some ESR1 target gene promoters. May be required for histone hyperacetylation. Involved in the estrogen-induced cell proliferation and cell cycle progression of breast cancer cells. Ref.13 |
| Catalytic activity | ATP + H2O = ADP + phosphate. |
| Subunit structure | Interacts with ESR1 and NCOA3 and these interactions are enhanced by estradiol. Ref.13 |
| Subcellular location | |
| Tissue specificity | Highly expressed in estrogen receptor positive breast tumors and in osteosarcoma tumors. Ref.7 Ref.9 Ref.12 |
| Induction | Up-regulated in breast, uterus, colon, ovary, and stomach tumors. Induced in breast cancer cells overexpressing NCOA3 or treated with estrogen. Down-regulated in 5-fluorouracil-resistant derivatives of the colon cancer cell line HCT116. Ref.1 Ref.10 Ref.13 |
| Sequence similarities | Belongs to the AAA ATPase family. Contains 1 bromo domain. |
| Sequence caution | The sequence AAF22032.1 differs from that shown. Reason: Erroneous initiation. The sequence AAH10686.1 differs from that shown. Reason: Contaminating sequence. Sequence of unknown origin in the N-terminal part (676-679). The sequence AAH19909.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Bromodomain Coiled coil |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Activator Hydrolase |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | regulation of transcription, DNA-dependent Inferred from electronic annotation. Source: UniProtKB-KW transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | nucleus Inferred from direct assay. Source: HPA |
| Molecular function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW ATPase activityInferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6PL18-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6PL18-2) The sequence of this isoform differs from the canonical sequence as follows: 1-170: Missing. 551-582: IVSTLLALMDGLDSRGEIVVIGATNRLDSIDP → YGWIGQQRGNCGHWCYEQARFYRSCFTKAWSL 583-1390: Missing. | ||||||
| Note: No experimental confirmation available. Dubious isoform. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1390 | 1390 | ATPase family AAA domain-containing protein 2 | PRO_0000084796 | |||||||||||||||||||||
Regions | |||||||||||||||||||||||||
| Domain | 1001 – 1071 | 71 | Bromo | ||||||||||||||||||||||
| Nucleotide binding | 467 – 474 | 8 | ATP Potential | ||||||||||||||||||||||
| Coiled coil | 970 – 994 | 25 | Potential | ||||||||||||||||||||||
| Coiled coil | 1086 – 1112 | 27 | Potential | ||||||||||||||||||||||
| Compositional bias | 250 – 285 | 36 | Asp-rich | ||||||||||||||||||||||
| Compositional bias | 357 – 366 | 10 | Poly-Ser | ||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||
| Modified residue | 132 | 1 | Phosphoserine Ref.11 | ||||||||||||||||||||||
| Modified residue | 170 | 1 | Phosphoserine Ref.17 | ||||||||||||||||||||||
| Modified residue | 342 | 1 | Phosphoserine Ref.8 | ||||||||||||||||||||||
| Modified residue | 746 | 1 | Phosphoserine Ref.15 | ||||||||||||||||||||||
| Modified residue | 751 | 1 | Phosphoserine Ref.6 Ref.15 | ||||||||||||||||||||||
| Modified residue | 1149 | 1 | Phosphothreonine Ref.15 | ||||||||||||||||||||||
| Modified residue | 1152 | 1 | Phosphothreonine Ref.15 | ||||||||||||||||||||||
| Modified residue | 1158 | 1 | Phosphothreonine Ref.15 Ref.16 | ||||||||||||||||||||||
| Modified residue | 1243 | 1 | Phosphoserine Ref.8 Ref.16 | ||||||||||||||||||||||
| Modified residue | 1302 | 1 | Phosphoserine Ref.14 Ref.15 Ref.17 | ||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||
| Alternative sequence | 1 – 170 | 170 | Missing in isoform 2. | VSP_015633 | |||||||||||||||||||||
| Alternative sequence | 551 – 582 | 32 | IVSTL…DSIDP → YGWIGQQRGNCGHWCYEQAR FYRSCFTKAWSL in isoform 2. | VSP_015634 | |||||||||||||||||||||
| Alternative sequence | 583 – 1390 | 808 | Missing in isoform 2. | VSP_015635 | |||||||||||||||||||||
| Natural variant | 1280 | 1 | I → T. Corresponds to variant rs3758122 [ dbSNP | Ensembl ]. | VAR_047625 | |||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||
| Mutagenesis | 473 | 1 | K → T: Reduces the ability to mediate estradiol-dependent induction of CCND1 and E2F1; when associated with Q-532. Ref.13 | ||||||||||||||||||||||
| Mutagenesis | 532 | 1 | E → Q: Reduces the ability to mediate estradiol-dependent induction of CCND1 and E2F1; when associated with T-473. Ref.13 | ||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||
| Helix | 981 – 1001 | 21 | |||||||||||||||||||||||
| Helix | 1004 – 1009 | 6 | |||||||||||||||||||||||
| Turn | 1015 – 1017 | 3 | |||||||||||||||||||||||
| Helix | 1021 – 1024 | 4 | |||||||||||||||||||||||
| Helix | 1031 – 1039 | 9 | |||||||||||||||||||||||
| Helix | 1046 – 1063 | 18 | |||||||||||||||||||||||
| Helix | 1072 – 1092 | 21 | |||||||||||||||||||||||
| Helix | 1095 – 1108 | 14 | |||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Suppression subtractive hybridization and expression profiling identifies a unique set of genes overexpressed in non-small-cell lung cancer." Petroziello J., Yamane A., Westendorf L., Thompson M., McDonagh C., Cerveny C., Law C.-L., Wahl A., Carter P. Oncogene 23:7734-7745(2004) [PubMed: 15334068] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INDUCTION. |
| [2] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 47-1390 (ISOFORM 1). Tissue: Lymph node and Testis. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Cerebellum, Cervix and Eye. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-978 (ISOFORM 1). Tissue: Spleen. |
| [5] | "Gene expression profiling in human fetal liver and identification of tissue- and developmental-stage-specific genes through compiled expression profiles and efficient cloning of full-length cDNAs." Yu Y., Zhang C., Zhou G., Wu S., Qu X., Wei H., Xing G., Dong C., Zhai Y., Wan J., Ouyang S., Li L., Zhang S., Zhou K., Zhang Y., Wu C., He F. Genome Res. 11:1392-1403(2001) [PubMed: 11483580] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 813-1390. Tissue: Fetal liver. |
| [6] | "Large-scale characterization of HeLa cell nuclear phosphoproteins." Beausoleil S.A., Jedrychowski M., Schwartz D., Elias J.E., Villen J., Li J., Cohn M.A., Cantley L.C., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 101:12130-12135(2004) [PubMed: 15302935] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-751, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [7] | "Gene-expression profiles to predict distant metastasis of lymph-node-negative primary breast cancer." Wang Y., Klijn J.G., Zhang Y., Sieuwerts A.M., Look M.P., Yang F., Talantov D., Timmermans M., Meijer-van Gelder M.E., Yu J., Jatkoe T., Berns E.M.J.J., Atkins D., Foekens J.A. Lancet 365:671-679(2005) [PubMed: 15721472] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [8] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-342 AND SER-1243, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "A consensus prognostic gene expression classifier for ER positive breast cancer." Teschendorff A.E., Naderi A., Barbosa-Morais N.L., Pinder S.E., Ellis I.O., Aparicio S., Brenton J.D., Caldas C. Genome Biol. 7:R101.1-R101.13(2006) [PubMed: 17076897] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [10] | "Cellular response to 5-fluorouracil (5-FU) in 5-FU-resistant colon cancer cell lines during treatment and recovery." De Angelis P.M., Svendsrud D.H., Kravik K.L., Stokke T. Mol. Cancer 5:20-20(2006) [PubMed: 16709241] [Abstract] Cited for: INDUCTION. |
| [11] | "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra." Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D. J. Proteome Res. 6:4150-4162(2007) [PubMed: 17924679] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-132, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "Prognostic significance of drug-regulated genes in high-grade osteosarcoma." Fellenberg J., Bernd L., Delling G., Witte D., Zahlten-Hinguranage A. Mod. Pathol. 20:1085-1094(2007) [PubMed: 17660802] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [13] | "ANCCA, an estrogen-regulated AAA+ ATPase coactivator for ERalpha, is required for coregulator occupancy and chromatin modification." Zou J.X., Revenko A.S., Li L.B., Gemo A.T., Chen H.-W. Proc. Natl. Acad. Sci. U.S.A. 104:18067-18072(2007) [PubMed: 17998543] [Abstract] Cited for: FUNCTION, INTERACTION WITH ESR1 AND NCOA3, SUBCELLULAR LOCATION, INDUCTION, MUTAGENESIS OF LYS-473 AND GLU-532. |
| [14] | "Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis." Wang B., Malik R., Nigg E.A., Korner R. Anal. Chem. 80:9526-9533(2008) [PubMed: 19007248] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1302, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [15] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-746; SER-751; THR-1149; THR-1152; THR-1158 AND SER-1302, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [16] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-1158 AND SER-1243, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [17] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-170 AND SER-1302, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [18] | "Crystal structure of the bromodomain of the human ATAD2." Structural genomics consortium (SGC) Submitted (FEB-2009) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (1.95 ANGSTROMS) OF 981-1108. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AY598335 mRNA. Translation: AAT06746.1. CR749832 mRNA. Translation: CAH18688.1. AL833653 mRNA. Translation: CAH56229.1. BC010686 mRNA. Translation: AAH10686.1. Sequence problems. BC019909 mRNA. Translation: AAH19909.1. Different initiation. BC113656 mRNA. Translation: AAI13657.1. AK097133 mRNA. Translation: BAC04959.1. AF118088 mRNA. Translation: AAF22032.1. Different initiation. | ||||||||||||
| IPI | IPI00170548. IPI00470801. | ||||||||||||
| RefSeq | NP_054828.2. NM_014109.3. | ||||||||||||
| UniGene | Hs.370834. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q6PL18. | ||||||||||||
| SMR | Q6PL18. Positions 420-727, 794-862, 981-1108. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| DIP | DIP-46197N. | ||||||||||||
| STRING | Q6PL18. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q6PL18. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 74762365. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q6PL18. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000287394; ENSP00000287394; ENSG00000156802. | ||||||||||||
| GeneID | 29028. | ||||||||||||
| KEGG | hsa:29028. | ||||||||||||
| UCSC | uc003yqh.2. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 29028. | ||||||||||||
| GeneCards | GC08M124401. | ||||||||||||
| H-InvDB | HIX0007764. | ||||||||||||
| HGNC | HGNC:30123. ATAD2. | ||||||||||||
| HPA | HPA019860. HPA029424. | ||||||||||||
| MIM | 611941. gene. | ||||||||||||
| neXtProt | NX_Q6PL18. | ||||||||||||
| PharmGKB | PA134895566. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | prNOG08683. | ||||||||||||
| GeneTree | ENSGT00550000074694. | ||||||||||||
| HOVERGEN | HBG080873. | ||||||||||||
| InParanoid | Q6PL18. | ||||||||||||
| OMA | MNRRRHA. | ||||||||||||
| OrthoDB | EOG441Q9S. | ||||||||||||
| PhylomeDB | Q6PL18. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q6PL18. | ||||||||||||
| Bgee | Q6PL18. | ||||||||||||
| CleanEx | HS_ATAD2. | ||||||||||||
| Genevestigator | Q6PL18. | ||||||||||||
| GermOnline | ENSG00000156802. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR003593. ATPase_AAA+_core. IPR003959. ATPase_AAA_core. IPR003960. ATPase_AAA_CS. IPR001487. Bromodomain. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:1.20.920.10. Bromodomain. 1 hit. | ||||||||||||
| Pfam | PF00004. AAA. 1 hit. PF00439. Bromodomain. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00503. BROMODOMAIN. | ||||||||||||
| SMART | SM00382. AAA. 1 hit. SM00297. BROMO. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF47370. Bromodomain. 1 hit. | ||||||||||||
| PROSITE | PS00674. AAA. 1 hit. PS00633. BROMODOMAIN_1. False negative. PS50014. BROMODOMAIN_2. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 51959. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | ATAD2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6PL18 Secondary accession number(s): Q14CR1 Q9UHS5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with