Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6PL18

- ATAD2_HUMAN

UniProt

Q6PL18 - ATAD2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

ATPase family AAA domain-containing protein 2

Gene

ATAD2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May be a transcriptional coactivator of the nuclear receptor ESR1 required to induce the expression of a subset of estradiol target genes, such as CCND1, MYC and E2F1. May play a role in the recruitment or occupancy of CREBBP at some ESR1 target gene promoters. May be required for histone hyperacetylation. Involved in the estrogen-induced cell proliferation and cell cycle progression of breast cancer cells.1 Publication

Catalytic activityi

ATP + H2O = ADP + phosphate.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi467 – 4748ATPSequence Analysis

GO - Molecular functioni

  1. ATPase activity Source: UniProt
  2. ATP binding Source: UniProtKB-KW

GO - Biological processi

  1. ATP catabolic process Source: UniProt
  2. positive regulation of transcription, DNA-templated Source: UniProt
  3. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Activator, Hydrolase

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
ATPase family AAA domain-containing protein 2 (EC:3.6.1.3)
Alternative name(s):
AAA nuclear coregulator cancer-associated protein
Short name:
ANCCA
Gene namesi
Name:ATAD2
ORF Names:L16, PRO2000
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 8

Organism-specific databases

HGNCiHGNC:30123. ATAD2.

Subcellular locationi

Nucleus 1 Publication

GO - Cellular componenti

  1. extracellular vesicular exosome Source: UniProt
  2. nucleus Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi473 – 4731K → T: Reduces the ability to mediate estradiol-dependent induction of CCND1 and E2F1; when associated with Q-532. 1 Publication
Mutagenesisi532 – 5321E → Q: Reduces the ability to mediate estradiol-dependent induction of CCND1 and E2F1; when associated with T-473. 1 Publication

Organism-specific databases

PharmGKBiPA134895566.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 13901390ATPase family AAA domain-containing protein 2PRO_0000084796Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei170 – 1701Phosphoserine1 Publication
Modified residuei327 – 3271Phosphoserine2 Publications
Modified residuei337 – 3371Phosphoserine1 Publication
Modified residuei746 – 7461Phosphoserine1 Publication
Modified residuei751 – 7511Phosphoserine1 Publication
Modified residuei1149 – 11491Phosphothreonine1 Publication
Modified residuei1152 – 11521Phosphothreonine1 Publication
Modified residuei1233 – 12331Phosphoserine1 Publication
Modified residuei1302 – 13021Phosphoserine3 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ6PL18.
PaxDbiQ6PL18.
PRIDEiQ6PL18.

PTM databases

PhosphoSiteiQ6PL18.

Expressioni

Tissue specificityi

Highly expressed in estrogen receptor positive breast tumors and in osteosarcoma tumors.3 Publications

Inductioni

Up-regulated in breast, uterus, colon, ovary, and stomach tumors. Induced in breast cancer cells overexpressing NCOA3 or treated with estrogen. Down-regulated in 5-fluorouracil-resistant derivatives of the colon cancer cell line HCT 116.3 Publications

Gene expression databases

BgeeiQ6PL18.
CleanExiHS_ATAD2.
ExpressionAtlasiQ6PL18. baseline and differential.
GenevestigatoriQ6PL18.

Organism-specific databases

HPAiCAB056158.
HPA019860.
HPA029424.

Interactioni

Subunit structurei

Interacts with ESR1 and NCOA3 and these interactions are enhanced by estradiol. Interacts with acetylated lysine residues on histone H1.4, H2A, H2B and H3 (in vitro).2 Publications

Protein-protein interaction databases

BioGridi118827. 13 interactions.
DIPiDIP-46197N.
IntActiQ6PL18. 1 interaction.
STRINGi9606.ENSP00000287394.

Structurei

Secondary structure

1
1390
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi981 – 100121Combined sources
Helixi1004 – 10096Combined sources
Turni1015 – 10173Combined sources
Helixi1021 – 10244Combined sources
Helixi1031 – 10399Combined sources
Helixi1046 – 106318Combined sources
Beta strandi1066 – 10683Combined sources
Helixi1069 – 109224Combined sources
Helixi1095 – 110612Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3DAIX-ray1.95A981-1108[»]
4QSPX-ray1.60A981-1108[»]
4QSQX-ray1.80A981-1108[»]
4QSRX-ray2.00A981-1108[»]
4QSSX-ray2.00A981-1108[»]
4QSTX-ray2.05A981-1108[»]
4QSUX-ray1.90A981-1108[»]
4QSVX-ray1.90A981-1108[»]
4QSWX-ray1.80A981-1108[»]
4QSXX-ray1.93A981-1108[»]
4QUTX-ray1.70A981-1108[»]
4QUUX-ray1.80A981-1108[»]
ProteinModelPortaliQ6PL18.
SMRiQ6PL18. Positions 981-1108.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ6PL18.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1001 – 107171BromoPROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili970 – 99425Sequence AnalysisAdd
BLAST
Coiled coili1086 – 111227Sequence AnalysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi250 – 28536Asp-richAdd
BLAST
Compositional biasi357 – 36610Poly-Ser

Sequence similaritiesi

Belongs to the AAA ATPase family.Curated
Contains 1 bromo domain.PROSITE-ProRule annotation

Keywords - Domaini

Bromodomain, Coiled coil

Phylogenomic databases

eggNOGiCOG0464.
GeneTreeiENSGT00550000074694.
HOVERGENiHBG080873.
InParanoidiQ6PL18.
OMAiPSVYENG.
OrthoDBiEOG76X5ZF.
PhylomeDBiQ6PL18.
TreeFamiTF314783.

Family and domain databases

Gene3Di1.20.920.10. 1 hit.
1.25.10.10. 1 hit.
3.40.50.300. 2 hits.
InterProiIPR003593. AAA+_ATPase.
IPR011989. ARM-like.
IPR003959. ATPase_AAA_core.
IPR003960. ATPase_AAA_CS.
IPR001487. Bromodomain.
IPR027417. P-loop_NTPase.
[Graphical view]
PfamiPF00004. AAA. 1 hit.
PF00439. Bromodomain. 1 hit.
[Graphical view]
PRINTSiPR00503. BROMODOMAIN.
SMARTiSM00382. AAA. 1 hit.
SM00297. BROMO. 1 hit.
[Graphical view]
SUPFAMiSSF47370. SSF47370. 1 hit.
SSF52540. SSF52540. 3 hits.
PROSITEiPS00674. AAA. 1 hit.
PS50014. BROMODOMAIN_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6PL18-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVVLRSSLEL HNHSAASATG SLDLSSDFLS LEHIGRRRLR SAGAAQKKPA
60 70 80 90 100
ATTAKAGDGS SVKEVETYHR TRALRSLRKD AQNSSDSSFE KNVEITEQLA
110 120 130 140 150
NGRHFTRQLA RQQADKKKEE HREDKVIPVT RSLRARNIVQ STEHLHEDNG
160 170 180 190 200
DVEVRRSCRI RSRYSGVNQS MLFDKLITNT AEAVLQKMDD MKKMRRQRMR
210 220 230 240 250
ELEDLGVFNE TEESNLNMYT RGKQKDIQRT DEETTDNQEG SVESSEEGED
260 270 280 290 300
QEHEDDGEDE DDEDDDDDDD DDDDDDDEDD EDEEDGEEEN QKRYYLRQRK
310 320 330 340 350
ATVYYQAPLE KPRHQRKPNI FYSGPASPAR PRYRLSSAGP RSPYCKRMNR
360 370 380 390 400
RRHAIHSSDS TSSSSSEDEQ HFERRRKRSR NRAINRCLPL NFRKDELKGI
410 420 430 440 450
YKDRMKIGAS LADVDPMQLD SSVRFDSVGG LSNHIAALKE MVVFPLLYPE
460 470 480 490 500
VFEKFKIQPP RGCLFYGPPG TGKTLVARAL ANECSQGDKR VAFFMRKGAD
510 520 530 540 550
CLSKWVGESE RQLRLLFDQA YQMRPSIIFF DEIDGLAPVR SSRQDQIHSS
560 570 580 590 600
IVSTLLALMD GLDSRGEIVV IGATNRLDSI DPALRRPGRF DREFLFSLPD
610 620 630 640 650
KEARKEILKI HTRDWNPKPL DTFLEELAEN CVGYCGADIK SICAEAALCA
660 670 680 690 700
LRRRYPQIYT TSEKLQLDLS SINISAKDFE VAMQKMIPAS QRAVTSPGQA
710 720 730 740 750
LSTVVKPLLQ NTVDKILEAL QRVFPHAEFR TNKTLDSDIS CPLLESDLAY
760 770 780 790 800
SDDDVPSVYE NGLSQKSSHK AKDNFNFLHL NRNACYQPMS FRPRILIVGE
810 820 830 840 850
PGFGQGSHLA PAVIHALEKF TVYTLDIPVL FGVSTTSPEE TCAQVIREAK
860 870 880 890 900
RTAPSIVYVP HIHVWWEIVG PTLKATFTTL LQNIPSFAPV LLLATSDKPH
910 920 930 940 950
SALPEEVQEL FIRDYGEIFN VQLPDKEERT KFFEDLILKQ AAKPPISKKK
960 970 980 990 1000
AVLQALEVLP VAPPPEPRSL TAEEVKRLEE QEEDTFRELR IFLRNVTHRL
1010 1020 1030 1040 1050
AIDKRFRVFT KPVDPDEVPD YVTVIKQPMD LSSVISKIDL HKYLTVKDYL
1060 1070 1080 1090 1100
RDIDLICSNA LEYNPDRDPG DRLIRHRACA LRDTAYAIIK EELDEDFEQL
1110 1120 1130 1140 1150
CEEIQESRKK RGCSSSKYAP SYYHVMPKQN STLVGDKRSD PEQNEKLKTP
1160 1170 1180 1190 1200
STPVACSTPA QLKRKIRKKS NWYLGTIKKR RKISQAKDDS QNAIDHKIES
1210 1220 1230 1240 1250
DTEETQDTSV DHNETGNTGE SSVEENEKQQ NASESKLELR NNSNTCNIEN
1260 1270 1280 1290 1300
ELEDSRKTTA CTELRDKIAC NGDASSSQII HISDENEGKE MCVLRMTRAR
1310 1320 1330 1340 1350
RSQVEQQQLI TVEKALAILS QPTPSLVVDH ERLKNLLKTV VKKSQNYNIF
1360 1370 1380 1390
QLENLYAVIS QCIYRHRKDH DKTSLIQKME QEVENFSCSR
Length:1,390
Mass (Da):158,554
Last modified:July 5, 2004 - v1
Checksum:iF43B30C77BB0F4BA
GO
Isoform 2 (identifier: Q6PL18-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-170: Missing.
     551-582: IVSTLLALMDGLDSRGEIVVIGATNRLDSIDP → YGWIGQQRGNCGHWCYEQARFYRSCFTKAWSL
     583-1390: Missing.

Note: No experimental confirmation available. Dubious isoform. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:412
Mass (Da):47,986
Checksum:i24E5F0638207B64A
GO

Sequence cautioni

The sequence AAF22032.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence AAH10686.1 differs from that shown. Reason: Contaminating sequence. Sequence of unknown origin in the N-terminal part (676-679).Curated
The sequence AAH19909.1 differs from that shown. Reason: Erroneous initiation. Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti1280 – 12801I → T.
Corresponds to variant rs3758122 [ dbSNP | Ensembl ].
VAR_047625

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 170170Missing in isoform 2. 1 PublicationVSP_015633Add
BLAST
Alternative sequencei551 – 58232IVSTL…DSIDP → YGWIGQQRGNCGHWCYEQAR FYRSCFTKAWSL in isoform 2. 1 PublicationVSP_015634Add
BLAST
Alternative sequencei583 – 1390808Missing in isoform 2. 1 PublicationVSP_015635Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY598335 mRNA. Translation: AAT06746.1.
CR749832 mRNA. Translation: CAH18688.1.
AL833653 mRNA. Translation: CAH56229.1.
BC010686 mRNA. Translation: AAH10686.1. Sequence problems.
BC019909 mRNA. Translation: AAH19909.1. Different initiation.
BC113656 mRNA. Translation: AAI13657.1.
AK097133 mRNA. Translation: BAC04959.1.
AF118088 mRNA. Translation: AAF22032.1. Different initiation.
CCDSiCCDS6343.1. [Q6PL18-1]
RefSeqiNP_054828.2. NM_014109.3. [Q6PL18-1]
UniGeneiHs.370834.

Genome annotation databases

EnsembliENST00000287394; ENSP00000287394; ENSG00000156802. [Q6PL18-1]
GeneIDi29028.
KEGGihsa:29028.
UCSCiuc003yqh.4. human. [Q6PL18-1]

Polymorphism databases

DMDMi74762365.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY598335 mRNA. Translation: AAT06746.1 .
CR749832 mRNA. Translation: CAH18688.1 .
AL833653 mRNA. Translation: CAH56229.1 .
BC010686 mRNA. Translation: AAH10686.1 . Sequence problems.
BC019909 mRNA. Translation: AAH19909.1 . Different initiation.
BC113656 mRNA. Translation: AAI13657.1 .
AK097133 mRNA. Translation: BAC04959.1 .
AF118088 mRNA. Translation: AAF22032.1 . Different initiation.
CCDSi CCDS6343.1. [Q6PL18-1 ]
RefSeqi NP_054828.2. NM_014109.3. [Q6PL18-1 ]
UniGenei Hs.370834.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
3DAI X-ray 1.95 A 981-1108 [» ]
4QSP X-ray 1.60 A 981-1108 [» ]
4QSQ X-ray 1.80 A 981-1108 [» ]
4QSR X-ray 2.00 A 981-1108 [» ]
4QSS X-ray 2.00 A 981-1108 [» ]
4QST X-ray 2.05 A 981-1108 [» ]
4QSU X-ray 1.90 A 981-1108 [» ]
4QSV X-ray 1.90 A 981-1108 [» ]
4QSW X-ray 1.80 A 981-1108 [» ]
4QSX X-ray 1.93 A 981-1108 [» ]
4QUT X-ray 1.70 A 981-1108 [» ]
4QUU X-ray 1.80 A 981-1108 [» ]
ProteinModelPortali Q6PL18.
SMRi Q6PL18. Positions 981-1108.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 118827. 13 interactions.
DIPi DIP-46197N.
IntActi Q6PL18. 1 interaction.
STRINGi 9606.ENSP00000287394.

Chemistry

BindingDBi Q6PL18.
ChEMBLi CHEMBL2150837.

PTM databases

PhosphoSitei Q6PL18.

Polymorphism databases

DMDMi 74762365.

Proteomic databases

MaxQBi Q6PL18.
PaxDbi Q6PL18.
PRIDEi Q6PL18.

Protocols and materials databases

DNASUi 29028.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000287394 ; ENSP00000287394 ; ENSG00000156802 . [Q6PL18-1 ]
GeneIDi 29028.
KEGGi hsa:29028.
UCSCi uc003yqh.4. human. [Q6PL18-1 ]

Organism-specific databases

CTDi 29028.
GeneCardsi GC08M124332.
H-InvDB HIX0007764.
HGNCi HGNC:30123. ATAD2.
HPAi CAB056158.
HPA019860.
HPA029424.
MIMi 611941. gene.
neXtProti NX_Q6PL18.
PharmGKBi PA134895566.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0464.
GeneTreei ENSGT00550000074694.
HOVERGENi HBG080873.
InParanoidi Q6PL18.
OMAi PSVYENG.
OrthoDBi EOG76X5ZF.
PhylomeDBi Q6PL18.
TreeFami TF314783.

Miscellaneous databases

ChiTaRSi ATAD2. human.
EvolutionaryTracei Q6PL18.
GenomeRNAii 29028.
NextBioi 51959.
PROi Q6PL18.
SOURCEi Search...

Gene expression databases

Bgeei Q6PL18.
CleanExi HS_ATAD2.
ExpressionAtlasi Q6PL18. baseline and differential.
Genevestigatori Q6PL18.

Family and domain databases

Gene3Di 1.20.920.10. 1 hit.
1.25.10.10. 1 hit.
3.40.50.300. 2 hits.
InterProi IPR003593. AAA+_ATPase.
IPR011989. ARM-like.
IPR003959. ATPase_AAA_core.
IPR003960. ATPase_AAA_CS.
IPR001487. Bromodomain.
IPR027417. P-loop_NTPase.
[Graphical view ]
Pfami PF00004. AAA. 1 hit.
PF00439. Bromodomain. 1 hit.
[Graphical view ]
PRINTSi PR00503. BROMODOMAIN.
SMARTi SM00382. AAA. 1 hit.
SM00297. BROMO. 1 hit.
[Graphical view ]
SUPFAMi SSF47370. SSF47370. 1 hit.
SSF52540. SSF52540. 3 hits.
PROSITEi PS00674. AAA. 1 hit.
PS50014. BROMODOMAIN_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Suppression subtractive hybridization and expression profiling identifies a unique set of genes overexpressed in non-small-cell lung cancer."
    Petroziello J., Yamane A., Westendorf L., Thompson M., McDonagh C., Cerveny C., Law C.-L., Wahl A., Carter P.
    Oncogene 23:7734-7745(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INDUCTION.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 47-1390 (ISOFORM 1).
    Tissue: Lymph node and Testis.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Cerebellum, Cervix and Eye.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-978 (ISOFORM 1).
    Tissue: Spleen.
  5. "Gene expression profiling in human fetal liver and identification of tissue- and developmental-stage-specific genes through compiled expression profiles and efficient cloning of full-length cDNAs."
    Yu Y., Zhang C., Zhou G., Wu S., Qu X., Wei H., Xing G., Dong C., Zhai Y., Wan J., Ouyang S., Li L., Zhang S., Zhou K., Zhang Y., Wu C., He F.
    Genome Res. 11:1392-1403(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 813-1390.
    Tissue: Fetal liver.
  6. "Gene-expression profiles to predict distant metastasis of lymph-node-negative primary breast cancer."
    Wang Y., Klijn J.G., Zhang Y., Sieuwerts A.M., Look M.P., Yang F., Talantov D., Timmermans M., Meijer-van Gelder M.E., Yu J., Jatkoe T., Berns E.M.J.J., Atkins D., Foekens J.A.
    Lancet 365:671-679(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  7. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. "A consensus prognostic gene expression classifier for ER positive breast cancer."
    Teschendorff A.E., Naderi A., Barbosa-Morais N.L., Pinder S.E., Ellis I.O., Aparicio S., Brenton J.D., Caldas C.
    Genome Biol. 7:R101.1-R101.13(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  9. "Cellular response to 5-fluorouracil (5-FU) in 5-FU-resistant colon cancer cell lines during treatment and recovery."
    De Angelis P.M., Svendsrud D.H., Kravik K.L., Stokke T.
    Mol. Cancer 5:20-20(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION.
  10. "Prognostic significance of drug-regulated genes in high-grade osteosarcoma."
    Fellenberg J., Bernd L., Delling G., Witte D., Zahlten-Hinguranage A.
    Mod. Pathol. 20:1085-1094(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  11. "ANCCA, an estrogen-regulated AAA+ ATPase coactivator for ERalpha, is required for coregulator occupancy and chromatin modification."
    Zou J.X., Revenko A.S., Li L.B., Gemo A.T., Chen H.-W.
    Proc. Natl. Acad. Sci. U.S.A. 104:18067-18072(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH ESR1 AND NCOA3, SUBCELLULAR LOCATION, INDUCTION, MUTAGENESIS OF LYS-473 AND GLU-532.
  12. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-746; SER-751; THR-1149; THR-1152 AND SER-1302, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  13. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  14. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-170 AND SER-1302, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  15. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-327; SER-337; SER-1233 AND SER-1302, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  16. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-327, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  17. Cited for: X-RAY CRYSTALLOGRAPHY (1.95 ANGSTROMS) OF 981-1108, SUBUNIT.

Entry informationi

Entry nameiATAD2_HUMAN
AccessioniPrimary (citable) accession number: Q6PL18
Secondary accession number(s): Q14CR1
, Q658P2, Q68CQ0, Q6PJV6, Q8N890, Q9UHS5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 13, 2005
Last sequence update: July 5, 2004
Last modified: November 26, 2014
This is version 104 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3