Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6PL18

- ATAD2_HUMAN

UniProt

Q6PL18 - ATAD2_HUMAN

Protein

ATPase family AAA domain-containing protein 2

Gene

ATAD2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 102 (01 Oct 2014)
      Sequence version 1 (05 Jul 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May be a transcriptional coactivator of the nuclear receptor ESR1 required to induce the expression of a subset of estradiol target genes, such as CCND1, MYC and E2F1. May play a role in the recruitment or occupancy of CREBBP at some ESR1 target gene promoters. May be required for histone hyperacetylation. Involved in the estrogen-induced cell proliferation and cell cycle progression of breast cancer cells.1 Publication

    Catalytic activityi

    ATP + H2O = ADP + phosphate.

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi467 – 4748ATPSequence Analysis

    GO - Molecular functioni

    1. ATPase activity Source: UniProt
    2. ATP binding Source: UniProtKB-KW

    GO - Biological processi

    1. ATP catabolic process Source: UniProt
    2. positive regulation of transcription, DNA-templated Source: UniProt
    3. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Molecular functioni

    Activator, Hydrolase

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    ATPase family AAA domain-containing protein 2 (EC:3.6.1.3)
    Alternative name(s):
    AAA nuclear coregulator cancer-associated protein
    Short name:
    ANCCA
    Gene namesi
    Name:ATAD2
    ORF Names:L16, PRO2000
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 8

    Organism-specific databases

    HGNCiHGNC:30123. ATAD2.

    Subcellular locationi

    Nucleus 1 Publication

    GO - Cellular componenti

    1. extracellular vesicular exosome Source: UniProt
    2. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi473 – 4731K → T: Reduces the ability to mediate estradiol-dependent induction of CCND1 and E2F1; when associated with Q-532. 1 Publication
    Mutagenesisi532 – 5321E → Q: Reduces the ability to mediate estradiol-dependent induction of CCND1 and E2F1; when associated with T-473. 1 Publication

    Organism-specific databases

    PharmGKBiPA134895566.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 13901390ATPase family AAA domain-containing protein 2PRO_0000084796Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei170 – 1701Phosphoserine1 Publication
    Modified residuei327 – 3271Phosphoserine2 Publications
    Modified residuei337 – 3371Phosphoserine1 Publication
    Modified residuei746 – 7461Phosphoserine1 Publication
    Modified residuei751 – 7511Phosphoserine1 Publication
    Modified residuei1149 – 11491Phosphothreonine1 Publication
    Modified residuei1152 – 11521Phosphothreonine1 Publication
    Modified residuei1233 – 12331Phosphoserine1 Publication
    Modified residuei1302 – 13021Phosphoserine3 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ6PL18.
    PaxDbiQ6PL18.
    PRIDEiQ6PL18.

    PTM databases

    PhosphoSiteiQ6PL18.

    Expressioni

    Tissue specificityi

    Highly expressed in estrogen receptor positive breast tumors and in osteosarcoma tumors.3 Publications

    Inductioni

    Up-regulated in breast, uterus, colon, ovary, and stomach tumors. Induced in breast cancer cells overexpressing NCOA3 or treated with estrogen. Down-regulated in 5-fluorouracil-resistant derivatives of the colon cancer cell line HCT 116.3 Publications

    Gene expression databases

    ArrayExpressiQ6PL18.
    BgeeiQ6PL18.
    CleanExiHS_ATAD2.
    GenevestigatoriQ6PL18.

    Organism-specific databases

    HPAiCAB056158.
    HPA019860.
    HPA029424.

    Interactioni

    Subunit structurei

    Interacts with ESR1 and NCOA3 and these interactions are enhanced by estradiol. Interacts with acetylated lysine residues on histone H1.4, H2A, H2B and H3 (in vitro).2 Publications

    Protein-protein interaction databases

    BioGridi118827. 13 interactions.
    DIPiDIP-46197N.
    IntActiQ6PL18. 1 interaction.
    STRINGi9606.ENSP00000287394.

    Structurei

    Secondary structure

    1
    1390
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi981 – 100121
    Helixi1004 – 10096
    Turni1015 – 10173
    Helixi1021 – 10244
    Helixi1031 – 10399
    Helixi1046 – 106318
    Beta strandi1066 – 10683
    Helixi1069 – 109224
    Helixi1095 – 110713

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    3DAIX-ray1.95A981-1108[»]
    ProteinModelPortaliQ6PL18.
    SMRiQ6PL18. Positions 981-1108.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ6PL18.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini1001 – 107171BromoPROSITE-ProRule annotationAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili970 – 99425Sequence AnalysisAdd
    BLAST
    Coiled coili1086 – 111227Sequence AnalysisAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi250 – 28536Asp-richAdd
    BLAST
    Compositional biasi357 – 36610Poly-Ser

    Sequence similaritiesi

    Belongs to the AAA ATPase family.Curated
    Contains 1 bromo domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Bromodomain, Coiled coil

    Phylogenomic databases

    eggNOGiCOG0464.
    HOVERGENiHBG080873.
    InParanoidiQ6PL18.
    OMAiPSVYENG.
    OrthoDBiEOG76X5ZF.
    PhylomeDBiQ6PL18.
    TreeFamiTF314783.

    Family and domain databases

    Gene3Di1.20.920.10. 1 hit.
    1.25.10.10. 1 hit.
    3.40.50.300. 2 hits.
    InterProiIPR003593. AAA+_ATPase.
    IPR011989. ARM-like.
    IPR003959. ATPase_AAA_core.
    IPR003960. ATPase_AAA_CS.
    IPR001487. Bromodomain.
    IPR027417. P-loop_NTPase.
    [Graphical view]
    PfamiPF00004. AAA. 1 hit.
    PF00439. Bromodomain. 1 hit.
    [Graphical view]
    PRINTSiPR00503. BROMODOMAIN.
    SMARTiSM00382. AAA. 1 hit.
    SM00297. BROMO. 1 hit.
    [Graphical view]
    SUPFAMiSSF47370. SSF47370. 1 hit.
    SSF52540. SSF52540. 3 hits.
    PROSITEiPS00674. AAA. 1 hit.
    PS50014. BROMODOMAIN_2. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6PL18-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MVVLRSSLEL HNHSAASATG SLDLSSDFLS LEHIGRRRLR SAGAAQKKPA     50
    ATTAKAGDGS SVKEVETYHR TRALRSLRKD AQNSSDSSFE KNVEITEQLA 100
    NGRHFTRQLA RQQADKKKEE HREDKVIPVT RSLRARNIVQ STEHLHEDNG 150
    DVEVRRSCRI RSRYSGVNQS MLFDKLITNT AEAVLQKMDD MKKMRRQRMR 200
    ELEDLGVFNE TEESNLNMYT RGKQKDIQRT DEETTDNQEG SVESSEEGED 250
    QEHEDDGEDE DDEDDDDDDD DDDDDDDEDD EDEEDGEEEN QKRYYLRQRK 300
    ATVYYQAPLE KPRHQRKPNI FYSGPASPAR PRYRLSSAGP RSPYCKRMNR 350
    RRHAIHSSDS TSSSSSEDEQ HFERRRKRSR NRAINRCLPL NFRKDELKGI 400
    YKDRMKIGAS LADVDPMQLD SSVRFDSVGG LSNHIAALKE MVVFPLLYPE 450
    VFEKFKIQPP RGCLFYGPPG TGKTLVARAL ANECSQGDKR VAFFMRKGAD 500
    CLSKWVGESE RQLRLLFDQA YQMRPSIIFF DEIDGLAPVR SSRQDQIHSS 550
    IVSTLLALMD GLDSRGEIVV IGATNRLDSI DPALRRPGRF DREFLFSLPD 600
    KEARKEILKI HTRDWNPKPL DTFLEELAEN CVGYCGADIK SICAEAALCA 650
    LRRRYPQIYT TSEKLQLDLS SINISAKDFE VAMQKMIPAS QRAVTSPGQA 700
    LSTVVKPLLQ NTVDKILEAL QRVFPHAEFR TNKTLDSDIS CPLLESDLAY 750
    SDDDVPSVYE NGLSQKSSHK AKDNFNFLHL NRNACYQPMS FRPRILIVGE 800
    PGFGQGSHLA PAVIHALEKF TVYTLDIPVL FGVSTTSPEE TCAQVIREAK 850
    RTAPSIVYVP HIHVWWEIVG PTLKATFTTL LQNIPSFAPV LLLATSDKPH 900
    SALPEEVQEL FIRDYGEIFN VQLPDKEERT KFFEDLILKQ AAKPPISKKK 950
    AVLQALEVLP VAPPPEPRSL TAEEVKRLEE QEEDTFRELR IFLRNVTHRL 1000
    AIDKRFRVFT KPVDPDEVPD YVTVIKQPMD LSSVISKIDL HKYLTVKDYL 1050
    RDIDLICSNA LEYNPDRDPG DRLIRHRACA LRDTAYAIIK EELDEDFEQL 1100
    CEEIQESRKK RGCSSSKYAP SYYHVMPKQN STLVGDKRSD PEQNEKLKTP 1150
    STPVACSTPA QLKRKIRKKS NWYLGTIKKR RKISQAKDDS QNAIDHKIES 1200
    DTEETQDTSV DHNETGNTGE SSVEENEKQQ NASESKLELR NNSNTCNIEN 1250
    ELEDSRKTTA CTELRDKIAC NGDASSSQII HISDENEGKE MCVLRMTRAR 1300
    RSQVEQQQLI TVEKALAILS QPTPSLVVDH ERLKNLLKTV VKKSQNYNIF 1350
    QLENLYAVIS QCIYRHRKDH DKTSLIQKME QEVENFSCSR 1390
    Length:1,390
    Mass (Da):158,554
    Last modified:July 5, 2004 - v1
    Checksum:iF43B30C77BB0F4BA
    GO
    Isoform 2 (identifier: Q6PL18-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-170: Missing.
         551-582: IVSTLLALMDGLDSRGEIVVIGATNRLDSIDP → YGWIGQQRGNCGHWCYEQARFYRSCFTKAWSL
         583-1390: Missing.

    Note: No experimental confirmation available. Dubious isoform. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:412
    Mass (Da):47,986
    Checksum:i24E5F0638207B64A
    GO

    Sequence cautioni

    The sequence AAH10686.1 differs from that shown. Reason: Contaminating sequence. Sequence of unknown origin in the N-terminal part (676-679).
    The sequence AAF22032.1 differs from that shown. Reason: Erroneous initiation.
    The sequence AAH19909.1 differs from that shown. Reason: Erroneous initiation.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti1280 – 12801I → T.
    Corresponds to variant rs3758122 [ dbSNP | Ensembl ].
    VAR_047625

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 170170Missing in isoform 2. 1 PublicationVSP_015633Add
    BLAST
    Alternative sequencei551 – 58232IVSTL…DSIDP → YGWIGQQRGNCGHWCYEQAR FYRSCFTKAWSL in isoform 2. 1 PublicationVSP_015634Add
    BLAST
    Alternative sequencei583 – 1390808Missing in isoform 2. 1 PublicationVSP_015635Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY598335 mRNA. Translation: AAT06746.1.
    CR749832 mRNA. Translation: CAH18688.1.
    AL833653 mRNA. Translation: CAH56229.1.
    BC010686 mRNA. Translation: AAH10686.1. Sequence problems.
    BC019909 mRNA. Translation: AAH19909.1. Different initiation.
    BC113656 mRNA. Translation: AAI13657.1.
    AK097133 mRNA. Translation: BAC04959.1.
    AF118088 mRNA. Translation: AAF22032.1. Different initiation.
    CCDSiCCDS6343.1. [Q6PL18-1]
    RefSeqiNP_054828.2. NM_014109.3. [Q6PL18-1]
    UniGeneiHs.370834.

    Genome annotation databases

    EnsembliENST00000287394; ENSP00000287394; ENSG00000156802. [Q6PL18-1]
    GeneIDi29028.
    KEGGihsa:29028.
    UCSCiuc003yqh.4. human. [Q6PL18-1]

    Polymorphism databases

    DMDMi74762365.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY598335 mRNA. Translation: AAT06746.1 .
    CR749832 mRNA. Translation: CAH18688.1 .
    AL833653 mRNA. Translation: CAH56229.1 .
    BC010686 mRNA. Translation: AAH10686.1 . Sequence problems.
    BC019909 mRNA. Translation: AAH19909.1 . Different initiation.
    BC113656 mRNA. Translation: AAI13657.1 .
    AK097133 mRNA. Translation: BAC04959.1 .
    AF118088 mRNA. Translation: AAF22032.1 . Different initiation.
    CCDSi CCDS6343.1. [Q6PL18-1 ]
    RefSeqi NP_054828.2. NM_014109.3. [Q6PL18-1 ]
    UniGenei Hs.370834.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    3DAI X-ray 1.95 A 981-1108 [» ]
    ProteinModelPortali Q6PL18.
    SMRi Q6PL18. Positions 981-1108.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 118827. 13 interactions.
    DIPi DIP-46197N.
    IntActi Q6PL18. 1 interaction.
    STRINGi 9606.ENSP00000287394.

    Chemistry

    ChEMBLi CHEMBL2150837.

    PTM databases

    PhosphoSitei Q6PL18.

    Polymorphism databases

    DMDMi 74762365.

    Proteomic databases

    MaxQBi Q6PL18.
    PaxDbi Q6PL18.
    PRIDEi Q6PL18.

    Protocols and materials databases

    DNASUi 29028.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000287394 ; ENSP00000287394 ; ENSG00000156802 . [Q6PL18-1 ]
    GeneIDi 29028.
    KEGGi hsa:29028.
    UCSCi uc003yqh.4. human. [Q6PL18-1 ]

    Organism-specific databases

    CTDi 29028.
    GeneCardsi GC08M124332.
    H-InvDB HIX0007764.
    HGNCi HGNC:30123. ATAD2.
    HPAi CAB056158.
    HPA019860.
    HPA029424.
    MIMi 611941. gene.
    neXtProti NX_Q6PL18.
    PharmGKBi PA134895566.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0464.
    HOVERGENi HBG080873.
    InParanoidi Q6PL18.
    OMAi PSVYENG.
    OrthoDBi EOG76X5ZF.
    PhylomeDBi Q6PL18.
    TreeFami TF314783.

    Miscellaneous databases

    ChiTaRSi ATAD2. human.
    EvolutionaryTracei Q6PL18.
    GenomeRNAii 29028.
    NextBioi 51959.
    PROi Q6PL18.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q6PL18.
    Bgeei Q6PL18.
    CleanExi HS_ATAD2.
    Genevestigatori Q6PL18.

    Family and domain databases

    Gene3Di 1.20.920.10. 1 hit.
    1.25.10.10. 1 hit.
    3.40.50.300. 2 hits.
    InterProi IPR003593. AAA+_ATPase.
    IPR011989. ARM-like.
    IPR003959. ATPase_AAA_core.
    IPR003960. ATPase_AAA_CS.
    IPR001487. Bromodomain.
    IPR027417. P-loop_NTPase.
    [Graphical view ]
    Pfami PF00004. AAA. 1 hit.
    PF00439. Bromodomain. 1 hit.
    [Graphical view ]
    PRINTSi PR00503. BROMODOMAIN.
    SMARTi SM00382. AAA. 1 hit.
    SM00297. BROMO. 1 hit.
    [Graphical view ]
    SUPFAMi SSF47370. SSF47370. 1 hit.
    SSF52540. SSF52540. 3 hits.
    PROSITEi PS00674. AAA. 1 hit.
    PS50014. BROMODOMAIN_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Suppression subtractive hybridization and expression profiling identifies a unique set of genes overexpressed in non-small-cell lung cancer."
      Petroziello J., Yamane A., Westendorf L., Thompson M., McDonagh C., Cerveny C., Law C.-L., Wahl A., Carter P.
      Oncogene 23:7734-7745(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INDUCTION.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 47-1390 (ISOFORM 1).
      Tissue: Lymph node and Testis.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Cerebellum, Cervix and Eye.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-978 (ISOFORM 1).
      Tissue: Spleen.
    5. "Gene expression profiling in human fetal liver and identification of tissue- and developmental-stage-specific genes through compiled expression profiles and efficient cloning of full-length cDNAs."
      Yu Y., Zhang C., Zhou G., Wu S., Qu X., Wei H., Xing G., Dong C., Zhai Y., Wan J., Ouyang S., Li L., Zhang S., Zhou K., Zhang Y., Wu C., He F.
      Genome Res. 11:1392-1403(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 813-1390.
      Tissue: Fetal liver.
    6. "Gene-expression profiles to predict distant metastasis of lymph-node-negative primary breast cancer."
      Wang Y., Klijn J.G., Zhang Y., Sieuwerts A.M., Look M.P., Yang F., Talantov D., Timmermans M., Meijer-van Gelder M.E., Yu J., Jatkoe T., Berns E.M.J.J., Atkins D., Foekens J.A.
      Lancet 365:671-679(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    7. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
      Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
      Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. "A consensus prognostic gene expression classifier for ER positive breast cancer."
      Teschendorff A.E., Naderi A., Barbosa-Morais N.L., Pinder S.E., Ellis I.O., Aparicio S., Brenton J.D., Caldas C.
      Genome Biol. 7:R101.1-R101.13(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    9. "Cellular response to 5-fluorouracil (5-FU) in 5-FU-resistant colon cancer cell lines during treatment and recovery."
      De Angelis P.M., Svendsrud D.H., Kravik K.L., Stokke T.
      Mol. Cancer 5:20-20(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: INDUCTION.
    10. "Prognostic significance of drug-regulated genes in high-grade osteosarcoma."
      Fellenberg J., Bernd L., Delling G., Witte D., Zahlten-Hinguranage A.
      Mod. Pathol. 20:1085-1094(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    11. "ANCCA, an estrogen-regulated AAA+ ATPase coactivator for ERalpha, is required for coregulator occupancy and chromatin modification."
      Zou J.X., Revenko A.S., Li L.B., Gemo A.T., Chen H.-W.
      Proc. Natl. Acad. Sci. U.S.A. 104:18067-18072(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH ESR1 AND NCOA3, SUBCELLULAR LOCATION, INDUCTION, MUTAGENESIS OF LYS-473 AND GLU-532.
    12. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-746; SER-751; THR-1149; THR-1152 AND SER-1302, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    13. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    14. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-170 AND SER-1302, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    15. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-327; SER-337; SER-1233 AND SER-1302, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    16. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-327, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    17. Cited for: X-RAY CRYSTALLOGRAPHY (1.95 ANGSTROMS) OF 981-1108, SUBUNIT.

    Entry informationi

    Entry nameiATAD2_HUMAN
    AccessioniPrimary (citable) accession number: Q6PL18
    Secondary accession number(s): Q14CR1
    , Q658P2, Q68CQ0, Q6PJV6, Q8N890, Q9UHS5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 13, 2005
    Last sequence update: July 5, 2004
    Last modified: October 1, 2014
    This is version 102 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 8
      Human chromosome 8: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3