SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6PIL6

- KCIP4_HUMAN

UniProt

Q6PIL6 - KCIP4_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Kv channel-interacting protein 4
Gene
KCNIP4, CALP, KCHIP4
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Probably modulates channels density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND2/Kv4.2 and KCND3/Kv4.3 currents By similarity.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Calcium bindingi133 – 144121 Reviewed prediction
Add
BLAST
Calcium bindingi169 – 180122 By similarity
Add
BLAST
Calcium bindingi217 – 228123 By similarity
Add
BLAST

GO - Molecular functioni

  1. calcium ion binding Source: InterPro
  2. potassium channel activity Source: UniProtKB-KW
  3. voltage-gated ion channel activity Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Ion channel, Potassium channel, Voltage-gated channel

Keywords - Biological processi

Ion transport, Potassium transport, Transport

Keywords - Ligandi

Calcium, Metal-binding, Potassium

Protein family/group databases

TCDBi5.B.1.1.7. the phagocyte (gp91(phox)) nadph oxidase family.

Names & Taxonomyi

Protein namesi
Recommended name:
Kv channel-interacting protein 4
Short name:
KChIP4
Alternative name(s):
A-type potassium channel modulatory protein 4
Calsenilin-like protein
Potassium channel-interacting protein 4
Gene namesi
Name:KCNIP4
Synonyms:CALP, KCHIP4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 4

Organism-specific databases

HGNCiHGNC:30083. KCNIP4.

Subcellular locationi

GO - Cellular componenti

  1. dendrite Source: Ensembl
  2. neuronal cell body Source: Ensembl
  3. plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134893552.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 250250Kv channel-interacting protein 4
PRO_0000073825Add
BLAST

Proteomic databases

PaxDbiQ6PIL6.
PRIDEiQ6PIL6.

PTM databases

PhosphoSiteiQ6PIL6.

Expressioni

Tissue specificityi

Predominantly expressed in brain.1 Publication

Gene expression databases

ArrayExpressiQ6PIL6.
BgeeiQ6PIL6.
CleanExiHS_KCNIP4.
GenevestigatoriQ6PIL6.

Organism-specific databases

HPAiHPA022862.

Interactioni

Subunit structurei

Component of heteromultimeric potassium channels By similarity. Interacts with KCND2. Interacts with KCND3, and the C-terminus of PSEN2 and probably PSEN1.1 Publication

Protein-protein interaction databases

BioGridi123244. 5 interactions.
STRINGi9606.ENSP00000398943.

Structurei

3D structure databases

ProteinModelPortaliQ6PIL6.
SMRiQ6PIL6. Positions 53-250.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini61 – 11757EF-hand 1; degenerate
Add
BLAST
Domaini120 – 15536EF-hand 2
Add
BLAST
Domaini156 – 19136EF-hand 3
Add
BLAST
Domaini204 – 23936EF-hand 4
Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni2 – 4443KIS By similarity
Add
BLAST
Regioni237 – 25014Interaction with KCND2 By similarity
Add
BLAST

Domaini

The KIS (K-channel inactivation suppressor) domain is required for converting A-type Kv4 current to a slowly inactivating delayed rectifier potassium current By similarity.

Sequence similaritiesi

Belongs to the recoverin family.
Contains 4 EF-hand domains.

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiCOG5126.
HOGENOMiHOG000233019.
HOVERGENiHBG108179.
OMAiLVFASIK.
OrthoDBiEOG7GJ6F3.
PhylomeDBiQ6PIL6.
TreeFamiTF318560.

Family and domain databases

Gene3Di1.10.238.10. 3 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR028846. Recoverin.
[Graphical view]
PANTHERiPTHR23055. PTHR23055. 1 hit.
PfamiPF13499. EF-hand_7. 1 hit.
[Graphical view]
SMARTiSM00054. EFh. 3 hits.
[Graphical view]
PROSITEiPS00018. EF_HAND_1. 3 hits.
PS50222. EF_HAND_2. 3 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6PIL6-1) [UniParc]FASTAAdd to Basket

Also known as: KChIP4.1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MNVRRVESIS AQLEEASSTG GFLYAQNSTK RSIKERLMKL LPCSAAKTSS    50
PAIQNSVEDE LEMATVRHRP EALELLEAQS KFTKKELQIL YRGFKNECPS 100
GVVNEETFKE IYSQFFPQGD STTYAHFLFN AFDTDHNGAV SFEDFIKGLS 150
ILLRGTVQEK LNWAFNLYDI NKDGYITKEE MLDIMKAIYD MMGKCTYPVL 200
KEDAPRQHVE TFFQKMDKNK DGVVTIDEFI ESCQKDENIM RSMQLFENVI 250
Length:250
Mass (Da):28,729
Last modified:July 5, 2004 - v1
Checksum:iDC6C758D73468092
GO
Isoform 2 (identifier: Q6PIL6-2) [UniParc]FASTAAdd to Basket

Also known as: KChIP4.2

The sequence of this isoform differs from the canonical sequence as follows:
     21-55: GFLYAQNSTKRSIKERLMKLLPCSAAKTSSPAIQN → D

Show »
Length:216
Mass (Da):25,008
Checksum:i17C4AFD3B4CFF23C
GO
Isoform 3 (identifier: Q6PIL6-3) [UniParc]FASTAAdd to Basket

Also known as: KChIP4bs, KCHIP4.2

The sequence of this isoform differs from the canonical sequence as follows:
     1-62: Missing.

Show »
Length:188
Mass (Da):21,945
Checksum:i9F46CA3A8A308410
GO
Isoform 4 (identifier: Q6PIL6-4) [UniParc]FASTAAdd to Basket

Also known as: KChIP4.4

The sequence of this isoform differs from the canonical sequence as follows:
     1-55: MNVRRVESIS...AKTSSPAIQN → MNLEGLEMIAVLIVIVLFVKLLEQFGLIEAGLED

Show »
Length:229
Mass (Da):26,502
Checksum:i08DF864F1A838BE8
GO
Isoform 5 (identifier: Q6PIL6-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-55: MNVRRVESIS...AKTSSPAIQN → MSGCRKRCKREILKFAQYLLRLLTGSLHTD

Show »
Length:225
Mass (Da):26,267
Checksum:iB140E66E43A89049
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6262Missing in isoform 3.
VSP_015066Add
BLAST
Alternative sequencei1 – 5555MNVRR…PAIQN → MNLEGLEMIAVLIVIVLFVK LLEQFGLIEAGLED in isoform 4.
VSP_015067Add
BLAST
Alternative sequencei1 – 5555MNVRR…PAIQN → MSGCRKRCKREILKFAQYLL RLLTGSLHTD in isoform 5.
VSP_043321Add
BLAST
Alternative sequencei21 – 5535GFLYA…PAIQN → D in isoform 2.
VSP_015068Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti29 – 291T → I in AAG36974. 1 Publication
Sequence conflicti29 – 291T → I in AAK53713. 1 Publication
Sequence conflicti32 – 321S → N in AAG36974. 1 Publication
Sequence conflicti32 – 321S → N in AAK53713. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF302044 mRNA. Translation: AAG36974.1.
AF305072 mRNA. Translation: AAG36977.1.
AF453246 mRNA. Translation: AAL86769.1.
AF367023 mRNA. Translation: AAK53712.1.
AF367024 mRNA. Translation: AAK53713.1.
AY029176 mRNA. Translation: AAK31594.1.
AY118170 mRNA. Translation: AAM81578.1.
DQ148487 mRNA. Translation: AAZ77804.1.
DQ148488 mRNA. Translation: AAZ77805.1.
DQ148489 mRNA. Translation: AAZ77806.1.
DQ148490 mRNA. Translation: AAZ77807.1.
DQ148491 mRNA. Translation: AAZ77808.1.
AK289922 mRNA. Translation: BAF82611.1.
AC096576 Genomic DNA. No translation available.
AC097505 Genomic DNA. No translation available.
AC098597 Genomic DNA. No translation available.
AC104065 Genomic DNA. Translation: AAY40911.1.
AC107462 Genomic DNA. No translation available.
AC108147 Genomic DNA. No translation available.
AC109360 Genomic DNA. No translation available.
AC109636 Genomic DNA. No translation available.
AC110296 Genomic DNA. No translation available.
AC110612 Genomic DNA. No translation available.
AC113606 Genomic DNA. No translation available.
AC116641 Genomic DNA. No translation available.
CH471069 Genomic DNA. Translation: EAW92798.1.
BC032520 mRNA. Translation: AAH32520.1.
CCDSiCCDS3428.1. [Q6PIL6-4]
CCDS43215.1. [Q6PIL6-2]
CCDS43216.1. [Q6PIL6-1]
CCDS43217.1. [Q6PIL6-5]
CCDS47035.1. [Q6PIL6-3]
RefSeqiNP_001030175.1. NM_001035003.1. [Q6PIL6-5]
NP_001030176.1. NM_001035004.1. [Q6PIL6-3]
NP_079497.2. NM_025221.5. [Q6PIL6-1]
NP_671710.1. NM_147181.3. [Q6PIL6-2]
NP_671711.1. NM_147182.3. [Q6PIL6-3]
NP_671712.1. NM_147183.3. [Q6PIL6-4]
UniGeneiHs.655705.

Genome annotation databases

EnsembliENST00000359001; ENSP00000351892; ENSG00000185774. [Q6PIL6-3]
ENST00000382148; ENSP00000371583; ENSG00000185774. [Q6PIL6-5]
ENST00000382150; ENSP00000371585; ENSG00000185774. [Q6PIL6-4]
ENST00000382152; ENSP00000371587; ENSG00000185774. [Q6PIL6-1]
ENST00000447367; ENSP00000399080; ENSG00000185774. [Q6PIL6-2]
ENST00000509207; ENSP00000423257; ENSG00000185774. [Q6PIL6-3]
GeneIDi80333.
KEGGihsa:80333.
UCSCiuc003gqf.1. human. [Q6PIL6-4]
uc003gqg.1. human. [Q6PIL6-1]
uc003gqh.1. human. [Q6PIL6-5]
uc021xmu.1. human. [Q6PIL6-2]

Polymorphism databases

DMDMi73621129.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF302044 mRNA. Translation: AAG36974.1 .
AF305072 mRNA. Translation: AAG36977.1 .
AF453246 mRNA. Translation: AAL86769.1 .
AF367023 mRNA. Translation: AAK53712.1 .
AF367024 mRNA. Translation: AAK53713.1 .
AY029176 mRNA. Translation: AAK31594.1 .
AY118170 mRNA. Translation: AAM81578.1 .
DQ148487 mRNA. Translation: AAZ77804.1 .
DQ148488 mRNA. Translation: AAZ77805.1 .
DQ148489 mRNA. Translation: AAZ77806.1 .
DQ148490 mRNA. Translation: AAZ77807.1 .
DQ148491 mRNA. Translation: AAZ77808.1 .
AK289922 mRNA. Translation: BAF82611.1 .
AC096576 Genomic DNA. No translation available.
AC097505 Genomic DNA. No translation available.
AC098597 Genomic DNA. No translation available.
AC104065 Genomic DNA. Translation: AAY40911.1 .
AC107462 Genomic DNA. No translation available.
AC108147 Genomic DNA. No translation available.
AC109360 Genomic DNA. No translation available.
AC109636 Genomic DNA. No translation available.
AC110296 Genomic DNA. No translation available.
AC110612 Genomic DNA. No translation available.
AC113606 Genomic DNA. No translation available.
AC116641 Genomic DNA. No translation available.
CH471069 Genomic DNA. Translation: EAW92798.1 .
BC032520 mRNA. Translation: AAH32520.1 .
CCDSi CCDS3428.1. [Q6PIL6-4 ]
CCDS43215.1. [Q6PIL6-2 ]
CCDS43216.1. [Q6PIL6-1 ]
CCDS43217.1. [Q6PIL6-5 ]
CCDS47035.1. [Q6PIL6-3 ]
RefSeqi NP_001030175.1. NM_001035003.1. [Q6PIL6-5 ]
NP_001030176.1. NM_001035004.1. [Q6PIL6-3 ]
NP_079497.2. NM_025221.5. [Q6PIL6-1 ]
NP_671710.1. NM_147181.3. [Q6PIL6-2 ]
NP_671711.1. NM_147182.3. [Q6PIL6-3 ]
NP_671712.1. NM_147183.3. [Q6PIL6-4 ]
UniGenei Hs.655705.

3D structure databases

ProteinModelPortali Q6PIL6.
SMRi Q6PIL6. Positions 53-250.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 123244. 5 interactions.
STRINGi 9606.ENSP00000398943.

Protein family/group databases

TCDBi 5.B.1.1.7. the phagocyte (gp91(phox)) nadph oxidase family.

PTM databases

PhosphoSitei Q6PIL6.

Polymorphism databases

DMDMi 73621129.

Proteomic databases

PaxDbi Q6PIL6.
PRIDEi Q6PIL6.

Protocols and materials databases

DNASUi 80333.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000359001 ; ENSP00000351892 ; ENSG00000185774 . [Q6PIL6-3 ]
ENST00000382148 ; ENSP00000371583 ; ENSG00000185774 . [Q6PIL6-5 ]
ENST00000382150 ; ENSP00000371585 ; ENSG00000185774 . [Q6PIL6-4 ]
ENST00000382152 ; ENSP00000371587 ; ENSG00000185774 . [Q6PIL6-1 ]
ENST00000447367 ; ENSP00000399080 ; ENSG00000185774 . [Q6PIL6-2 ]
ENST00000509207 ; ENSP00000423257 ; ENSG00000185774 . [Q6PIL6-3 ]
GeneIDi 80333.
KEGGi hsa:80333.
UCSCi uc003gqf.1. human. [Q6PIL6-4 ]
uc003gqg.1. human. [Q6PIL6-1 ]
uc003gqh.1. human. [Q6PIL6-5 ]
uc021xmu.1. human. [Q6PIL6-2 ]

Organism-specific databases

CTDi 80333.
GeneCardsi GC04M020814.
H-InvDB HIX0120159.
HGNCi HGNC:30083. KCNIP4.
HPAi HPA022862.
MIMi 608182. gene.
neXtProti NX_Q6PIL6.
PharmGKBi PA134893552.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5126.
HOGENOMi HOG000233019.
HOVERGENi HBG108179.
OMAi LVFASIK.
OrthoDBi EOG7GJ6F3.
PhylomeDBi Q6PIL6.
TreeFami TF318560.

Miscellaneous databases

ChiTaRSi KCNIP4. human.
GenomeRNAii 80333.
NextBioi 70886.
PROi Q6PIL6.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q6PIL6.
Bgeei Q6PIL6.
CleanExi HS_KCNIP4.
Genevestigatori Q6PIL6.

Family and domain databases

Gene3Di 1.10.238.10. 3 hits.
InterProi IPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR028846. Recoverin.
[Graphical view ]
PANTHERi PTHR23055. PTHR23055. 1 hit.
Pfami PF13499. EF-hand_7. 1 hit.
[Graphical view ]
SMARTi SM00054. EFh. 3 hits.
[Graphical view ]
PROSITEi PS00018. EF_HAND_1. 3 hits.
PS50222. EF_HAND_2. 3 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and characterization of CALP/KChIP4, a novel EF-hand protein interacting with presenilin 2 and voltage-gated potassium channel subunit Kv4."
    Morohashi Y., Hatano N., Ohya S., Takikawa R., Watabiki T., Takasugi N., Imaizumi Y., Tomita T., Iwatsubo T.
    J. Biol. Chem. 277:14965-14975(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH KCND2; PSEN1 AND PSEN2.
  2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
  3. Isbrandt D., Pongs O.
    Submitted (MAR-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4).
  4. "Structure, alternative splicing, and expression of the human and mouse KCNIP gene family."
    Pruunsild P., Timmusk T.
    Genomics 86:581-593(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4 AND 5), ALTERNATIVE SPLICING.
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Hippocampus.
  6. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Eye.

Entry informationi

Entry nameiKCIP4_HUMAN
AccessioniPrimary (citable) accession number: Q6PIL6
Secondary accession number(s): Q3YAB8
, Q3YAB9, Q3YAC0, Q3YAC1, Q3YAC2, Q4W5G8, Q8NEU0, Q9BWT2, Q9H294, Q9H2A4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 16, 2005
Last sequence update: July 5, 2004
Last modified: July 9, 2014
This is version 98 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi