Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q6PIL6 (KCIP4_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 95. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Kv channel-interacting protein 4

Short name=KChIP4
Alternative name(s):
A-type potassium channel modulatory protein 4
Calsenilin-like protein
Potassium channel-interacting protein 4
Gene names
Name:KCNIP4
Synonyms:CALP, KCHIP4
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length250 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Probably modulates channels density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND2/Kv4.2 and KCND3/Kv4.3 currents By similarity. Ref.1

Subunit structure

Component of heteromultimeric potassium channels By similarity. Interacts with KCND2. Interacts with KCND3, and the C-terminus of PSEN2 and probably PSEN1. Ref.1

Subcellular location

Cell membrane; Peripheral membrane protein By similarity.

Tissue specificity

Predominantly expressed in brain. Ref.1

Domain

The KIS (K-channel inactivation suppressor) domain is required for converting A-type Kv4 current to a slowly inactivating delayed rectifier potassium current By similarity.

Sequence similarities

Belongs to the recoverin family.

Contains 4 EF-hand domains.

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q6PIL6-1)

Also known as: KChIP4.1;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q6PIL6-2)

Also known as: KChIP4.2;

The sequence of this isoform differs from the canonical sequence as follows:
     21-55: GFLYAQNSTKRSIKERLMKLLPCSAAKTSSPAIQN → D
Isoform 3 (identifier: Q6PIL6-3)

Also known as: KChIP4bs; KCHIP4.2;

The sequence of this isoform differs from the canonical sequence as follows:
     1-62: Missing.
Isoform 4 (identifier: Q6PIL6-4)

Also known as: KChIP4.4;

The sequence of this isoform differs from the canonical sequence as follows:
     1-55: MNVRRVESIS...AKTSSPAIQN → MNLEGLEMIAVLIVIVLFVKLLEQFGLIEAGLED
Isoform 5 (identifier: Q6PIL6-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-55: MNVRRVESIS...AKTSSPAIQN → MSGCRKRCKREILKFAQYLLRLLTGSLHTD

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 250250Kv channel-interacting protein 4
PRO_0000073825

Regions

Domain61 – 11757EF-hand 1; degenerate
Domain120 – 15536EF-hand 2
Domain156 – 19136EF-hand 3
Domain204 – 23936EF-hand 4
Calcium binding133 – 144121 Potential
Calcium binding169 – 180122 By similarity
Calcium binding217 – 228123 By similarity
Region2 – 4443KIS By similarity
Region237 – 25014Interaction with KCND2 By similarity

Natural variations

Alternative sequence1 – 6262Missing in isoform 3.
VSP_015066
Alternative sequence1 – 5555MNVRR…PAIQN → MNLEGLEMIAVLIVIVLFVK LLEQFGLIEAGLED in isoform 4.
VSP_015067
Alternative sequence1 – 5555MNVRR…PAIQN → MSGCRKRCKREILKFAQYLL RLLTGSLHTD in isoform 5.
VSP_043321
Alternative sequence21 – 5535GFLYA…PAIQN → D in isoform 2.
VSP_015068

Experimental info

Sequence conflict291T → I in AAG36974. Ref.1
Sequence conflict291T → I in AAK53713. Ref.3
Sequence conflict321S → N in AAG36974. Ref.1
Sequence conflict321S → N in AAK53713. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (KChIP4.1) [UniParc].

Last modified July 5, 2004. Version 1.
Checksum: DC6C758D73468092

FASTA25028,729
        10         20         30         40         50         60 
MNVRRVESIS AQLEEASSTG GFLYAQNSTK RSIKERLMKL LPCSAAKTSS PAIQNSVEDE 

        70         80         90        100        110        120 
LEMATVRHRP EALELLEAQS KFTKKELQIL YRGFKNECPS GVVNEETFKE IYSQFFPQGD 

       130        140        150        160        170        180 
STTYAHFLFN AFDTDHNGAV SFEDFIKGLS ILLRGTVQEK LNWAFNLYDI NKDGYITKEE 

       190        200        210        220        230        240 
MLDIMKAIYD MMGKCTYPVL KEDAPRQHVE TFFQKMDKNK DGVVTIDEFI ESCQKDENIM 

       250 
RSMQLFENVI 

« Hide

Isoform 2 (KChIP4.2) [UniParc].

Checksum: 17C4AFD3B4CFF23C
Show »

FASTA21625,008
Isoform 3 (KChIP4bs) (KCHIP4.2) [UniParc].

Checksum: 9F46CA3A8A308410
Show »

FASTA18821,945
Isoform 4 (KChIP4.4) [UniParc].

Checksum: 08DF864F1A838BE8
Show »

FASTA22926,502
Isoform 5 [UniParc].

Checksum: B140E66E43A89049
Show »

FASTA22526,267

References

« Hide 'large scale' references
[1]"Molecular cloning and characterization of CALP/KChIP4, a novel EF-hand protein interacting with presenilin 2 and voltage-gated potassium channel subunit Kv4."
Morohashi Y., Hatano N., Ohya S., Takikawa R., Watabiki T., Takasugi N., Imaizumi Y., Tomita T., Iwatsubo T.
J. Biol. Chem. 277:14965-14975(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH KCND2; PSEN1 AND PSEN2.
[2]"Elimination of fast inactivation in Kv4 A-type potassium channels by an auxiliary subunit domain."
Holmqvist M.H., Cao J., Hernandez-Pineda R., Jacobson M.D., Carroll K.I., Sung M.A., Betty M., Ge P., Gilbride K.J., Brown M.E., Jurman M.E., Lawson D., Silos-Santiago I., Xie Y., Covarrubias M., Rhodes K.J., Distefano P.S., An W.F.
Proc. Natl. Acad. Sci. U.S.A. 99:1035-1040(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
[3]Isbrandt D., Pongs O.
Submitted (MAR-2001) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4).
[4]"Structure, alternative splicing, and expression of the human and mouse KCNIP gene family."
Pruunsild P., Timmusk T.
Genomics 86:581-593(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4 AND 5), ALTERNATIVE SPLICING.
[5]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Hippocampus.
[6]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Eye.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF302044 mRNA. Translation: AAG36974.1.
AF305072 mRNA. Translation: AAG36977.1.
AF453246 mRNA. Translation: AAL86769.1.
AF367023 mRNA. Translation: AAK53712.1.
AF367024 mRNA. Translation: AAK53713.1.
AY029176 mRNA. Translation: AAK31594.1.
AY118170 mRNA. Translation: AAM81578.1.
DQ148487 mRNA. Translation: AAZ77804.1.
DQ148488 mRNA. Translation: AAZ77805.1.
DQ148489 mRNA. Translation: AAZ77806.1.
DQ148490 mRNA. Translation: AAZ77807.1.
DQ148491 mRNA. Translation: AAZ77808.1.
AK289922 mRNA. Translation: BAF82611.1.
AC096576 Genomic DNA. No translation available.
AC097505 Genomic DNA. No translation available.
AC098597 Genomic DNA. No translation available.
AC104065 Genomic DNA. Translation: AAY40911.1.
AC107462 Genomic DNA. No translation available.
AC108147 Genomic DNA. No translation available.
AC109360 Genomic DNA. No translation available.
AC109636 Genomic DNA. No translation available.
AC110296 Genomic DNA. No translation available.
AC110612 Genomic DNA. No translation available.
AC113606 Genomic DNA. No translation available.
AC116641 Genomic DNA. No translation available.
CH471069 Genomic DNA. Translation: EAW92798.1.
BC032520 mRNA. Translation: AAH32520.1.
RefSeqNP_001030175.1. NM_001035003.1.
NP_001030176.1. NM_001035004.1.
NP_079497.2. NM_025221.5.
NP_671710.1. NM_147181.3.
NP_671711.1. NM_147182.3.
NP_671712.1. NM_147183.3.
UniGeneHs.655705.

3D structure databases

ProteinModelPortalQ6PIL6.
SMRQ6PIL6. Positions 53-250.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid123244. 5 interactions.
STRING9606.ENSP00000398943.

Protein family/group databases

TCDB5.B.1.1.7. the phagocyte (gp91(phox)) nadph oxidase family.

PTM databases

PhosphoSiteQ6PIL6.

Polymorphism databases

DMDM73621129.

Proteomic databases

PaxDbQ6PIL6.
PRIDEQ6PIL6.

Protocols and materials databases

DNASU80333.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000359001; ENSP00000351892; ENSG00000185774. [Q6PIL6-3]
ENST00000382148; ENSP00000371583; ENSG00000185774. [Q6PIL6-5]
ENST00000382150; ENSP00000371585; ENSG00000185774. [Q6PIL6-4]
ENST00000382152; ENSP00000371587; ENSG00000185774. [Q6PIL6-1]
ENST00000447367; ENSP00000399080; ENSG00000185774. [Q6PIL6-2]
ENST00000509207; ENSP00000423257; ENSG00000185774. [Q6PIL6-3]
GeneID80333.
KEGGhsa:80333.
UCSCuc003gqf.1. human. [Q6PIL6-4]
uc003gqg.1. human. [Q6PIL6-1]
uc003gqh.1. human. [Q6PIL6-5]
uc021xmu.1. human. [Q6PIL6-2]

Organism-specific databases

CTD80333.
GeneCardsGC04M020814.
H-InvDBHIX0120159.
HGNCHGNC:30083. KCNIP4.
HPAHPA022862.
MIM608182. gene.
neXtProtNX_Q6PIL6.
PharmGKBPA134893552.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5126.
HOGENOMHOG000233019.
HOVERGENHBG108179.
OMALVFASIK.
OrthoDBEOG7GJ6F3.
PhylomeDBQ6PIL6.
TreeFamTF318560.

Gene expression databases

ArrayExpressQ6PIL6.
BgeeQ6PIL6.
CleanExHS_KCNIP4.
GenevestigatorQ6PIL6.

Family and domain databases

Gene3D1.10.238.10. 3 hits.
InterProIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR001125. Recoverin_like.
[Graphical view]
PfamPF13499. EF-hand_7. 1 hit.
[Graphical view]
PRINTSPR00450. RECOVERIN.
SMARTSM00054. EFh. 3 hits.
[Graphical view]
PROSITEPS00018. EF_HAND_1. 3 hits.
PS50222. EF_HAND_2. 3 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSKCNIP4. human.
GenomeRNAi80333.
NextBio70886.
PROQ6PIL6.
SOURCESearch...

Entry information

Entry nameKCIP4_HUMAN
AccessionPrimary (citable) accession number: Q6PIL6
Secondary accession number(s): Q3YAB8 expand/collapse secondary AC list , Q3YAB9, Q3YAC0, Q3YAC1, Q3YAC2, Q4W5G8, Q8NEU0, Q9BWT2, Q9H294, Q9H2A4
Entry history
Integrated into UniProtKB/Swiss-Prot: August 16, 2005
Last sequence update: July 5, 2004
Last modified: April 16, 2014
This is version 95 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 4

Human chromosome 4: entries, gene names and cross-references to MIM