Q6PIL6 (KCIP4_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 71.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Kv channel-interacting protein 4 Short name=KChIP4 Alternative name(s): A-type potassium channel modulatory protein 4 Calsenilin-like protein Potassium channel-interacting protein 4 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 250 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Probably modulates channels density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND2/Kv4.2 and KCND3/Kv4.3 currents By similarity. Ref.1 |
| Subunit structure | Component of heteromultimeric potassium channels By similarity. Interacts with KCND2. Interacts with KCND3, and the C-terminus of PSEN2 and probably PSEN1. Ref.1 |
| Subcellular location | Cell membrane; Peripheral membrane protein By similarity. |
| Tissue specificity | Predominantly expressed in brain. Ref.1 |
| Domain | The KIS (K-channel inactivation suppressor) domain is required for converting A-type Kv4 current to a slowly inactivating delayed rectifier potassium current By similarity. |
| Sequence similarities | Belongs to the recoverin family. Contains 4 EF-hand domains. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ion transport Potassium transport Transport |
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat |
| Ligand | Calcium Potassium |
| Molecular function | Ionic channel Potassium channel Voltage-gated channel |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | plasma membrane Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | calcium ion binding Inferred from electronic annotation. Source: InterPro potassium channel activityInferred from electronic annotation. Source: UniProtKB-KW voltage-gated ion channel activityInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6PIL6-1) Also known as: KChIP4.1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6PIL6-2) Also known as: KChIP4.2; The sequence of this isoform differs from the canonical sequence as follows: 21-55: GFLYAQNSTKRSIKERLMKLLPCSAAKTSSPAIQN → D | ||||||
| Isoform 3 (identifier: Q6PIL6-3) Also known as: KChIP4bs; KCHIP4.2; The sequence of this isoform differs from the canonical sequence as follows: 1-62: Missing. | ||||||
| Isoform 4 (identifier: Q6PIL6-4) Also known as: KChIP4.4; The sequence of this isoform differs from the canonical sequence as follows: 1-55: MNVRRVESIS...AKTSSPAIQN → MNLEGLEMIAVLIVIVLFVKLLEQFGLIEAGLED |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 250 | 250 | Kv channel-interacting protein 4 | PRO_0000073825 | |||||
Regions | |||||||||
| Domain | 61 – 117 | 57 | EF-hand 1; degenerate | ||||||
| Domain | 120 – 155 | 36 | EF-hand 2 | ||||||
| Domain | 156 – 191 | 36 | EF-hand 3 | ||||||
| Domain | 204 – 239 | 36 | EF-hand 4 | ||||||
| Calcium binding | 133 – 144 | 12 | 1 Potential | ||||||
| Calcium binding | 169 – 180 | 12 | 2 By similarity | ||||||
| Calcium binding | 217 – 228 | 12 | 3 By similarity | ||||||
| Region | 2 – 44 | 43 | KIS By similarity | ||||||
| Region | 237 – 250 | 14 | Interaction with KCND2 By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 62 | 62 | Missing in isoform 3. | VSP_015066 | |||||
| Alternative sequence | 1 – 55 | 55 | MNVRR…PAIQN → MNLEGLEMIAVLIVIVLFVK LLEQFGLIEAGLED in isoform 4. | VSP_015067 | |||||
| Alternative sequence | 21 – 55 | 35 | GFLYA…PAIQN → D in isoform 2. | VSP_015068 | |||||
Experimental info | |||||||||
| Sequence conflict | 29 | 1 | T → I in AAG36974. Ref.1 | ||||||
| Sequence conflict | 29 | 1 | T → I in AAK53713. Ref.3 | ||||||
| Sequence conflict | 32 | 1 | S → N in AAG36974. Ref.1 | ||||||
| Sequence conflict | 32 | 1 | S → N in AAK53713. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and characterization of CALP/KChIP4, a novel EF-hand protein interacting with presenilin 2 and voltage-gated potassium channel subunit Kv4." Morohashi Y., Hatano N., Ohya S., Takikawa R., Watabiki T., Takasugi N., Imaizumi Y., Tomita T., Iwatsubo T. J. Biol. Chem. 277:14965-14975(2002) [PubMed: 11847232] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH KCND2; PSEN1 AND PSEN2. |
| [2] | "Elimination of fast inactivation in Kv4 A-type potassium channels by an auxiliary subunit domain." Holmqvist M.H., Cao J., Hernandez-Pineda R., Jacobson M.D., Carroll K.I., Sung M.A., Betty M., Ge P., Gilbride K.J., Brown M.E., Jurman M.E., Lawson D., Silos-Santiago I., Xie Y., Covarrubias M., Rhodes K.J., Distefano P.S., An W.F. Proc. Natl. Acad. Sci. U.S.A. 99:1035-1040(2002) [PubMed: 11805342] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). |
| [3] | Isbrandt D., Pongs O. Submitted (MAR-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4). |
| [4] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed: 15815621] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Eye. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF302044 mRNA. Translation: AAG36974.1. AF305072 mRNA. Translation: AAG36977.1. AF453246 mRNA. Translation: AAL86769.1. AF367023 mRNA. Translation: AAK53712.1. AF367024 mRNA. Translation: AAK53713.1. AY029176 mRNA. Translation: AAK31594.1. AY118170 mRNA. Translation: AAM81578.1. AC104065 Genomic DNA. Translation: AAY40911.1. AC109636 Genomic DNA. No translation available. BC032520 mRNA. Translation: AAH32520.1. |
| IPI | IPI00022716. IPI00160317. IPI00168749. IPI00419434. |
| RefSeq | NP_001030176.1. NM_001035004.1. NP_079497.2. NM_025221.5. NP_671710.1. NM_147181.3. NP_671711.1. NM_147182.3. NP_671712.1. NM_147183.3. |
| UniGene | Hs.655705. |
3D structure databases | |
| ProteinModelPortal | Q6PIL6. |
| SMR | Q6PIL6. Positions 53-250. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q6PIL6. |
PTM databases | |
| PhosphoSite | Q6PIL6. |
Polymorphism databases | |
| DMDM | 73621129. |
Proteomic databases | |
| PRIDE | Q6PIL6. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSRNOT00000049743; ENSRNOP00000042016; ENSRNOG00000032350. ENST00000413487; ENSP00000398943; ENSG00000185774. |
| GeneID | 80333. |
| KEGG | hsa:80333. |
| UCSC | uc003gqd.2. human. uc010iel.1. human. |
Organism-specific databases | |
| CTD | 80333. |
| GeneCards | GC04M020814. |
| HGNC | HGNC:30083. KCNIP4. |
| HPA | HPA022862. |
| MIM | 608182. gene. |
| neXtProt | NX_Q6PIL6. |
| GenAtlas | Search... |
Phylogenomic databases | |
| GeneTree | ENSGT00560000076973. |
| HOVERGEN | HBG108179. |
| OrthoDB | EOG4K6G52. |
| PhylomeDB | Q6PIL6. |
Gene expression databases | |
| ArrayExpress | Q6PIL6. |
| Bgee | Q6PIL6. |
| CleanEx | HS_KCNIP4. |
| Genevestigator | Q6PIL6. |
| GermOnline | ENSG00000185774. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR018248. EF-hand. IPR011992. EF-hand-like_dom. IPR018247. EF_Hand_1_Ca_BS. IPR018249. EF_HAND_2. IPR002048. EF_hand_Ca-bd. IPR001125. Recoverin. [Graphical view] |
| Gene3D | G3DSA:1.10.238.10. EF-Hand_type. 1 hit. |
| Pfam | PF00036. efhand. 1 hit. [Graphical view] |
| PRINTS | PR00450. RECOVERIN. |
| SMART | SM00054. EFh. 3 hits. [Graphical view] |
| PROSITE | PS00018. EF_HAND_1. 3 hits. PS50222. EF_HAND_2. 3 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 70886. |
| SOURCE | Search... |
Entry information
| Entry name | KCIP4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6PIL6 Secondary accession number(s): Q4W5G8 Q9H2A4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 4 Human chromosome 4: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with