Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6PIL6

- KCIP4_HUMAN

UniProt

Q6PIL6 - KCIP4_HUMAN

Protein

Kv channel-interacting protein 4

Gene

KCNIP4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 99 (01 Oct 2014)
      Sequence version 1 (05 Jul 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Probably modulates channels density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND2/Kv4.2 and KCND3/Kv4.3 currents By similarity.By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Calcium bindingi133 – 144121PROSITE-ProRule annotationAdd
    BLAST
    Calcium bindingi169 – 180122PROSITE-ProRule annotationAdd
    BLAST
    Calcium bindingi217 – 228123PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. calcium ion binding Source: InterPro
    2. potassium channel activity Source: UniProtKB-KW
    3. voltage-gated ion channel activity Source: UniProtKB-KW

    Keywords - Molecular functioni

    Ion channel, Potassium channel, Voltage-gated channel

    Keywords - Biological processi

    Ion transport, Potassium transport, Transport

    Keywords - Ligandi

    Calcium, Metal-binding, Potassium

    Protein family/group databases

    TCDBi5.B.1.1.7. the phagocyte (gp91(phox)) nadph oxidase family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Kv channel-interacting protein 4
    Short name:
    KChIP4
    Alternative name(s):
    A-type potassium channel modulatory protein 4
    Calsenilin-like protein
    Potassium channel-interacting protein 4
    Gene namesi
    Name:KCNIP4
    Synonyms:CALP, KCHIP4
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 4

    Organism-specific databases

    HGNCiHGNC:30083. KCNIP4.

    Subcellular locationi

    Cell membrane By similarity; Peripheral membrane protein By similarity

    GO - Cellular componenti

    1. dendrite Source: Ensembl
    2. neuronal cell body Source: Ensembl
    3. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134893552.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 250250Kv channel-interacting protein 4PRO_0000073825Add
    BLAST

    Proteomic databases

    PaxDbiQ6PIL6.
    PRIDEiQ6PIL6.

    PTM databases

    PhosphoSiteiQ6PIL6.

    Expressioni

    Tissue specificityi

    Predominantly expressed in brain.1 Publication

    Gene expression databases

    ArrayExpressiQ6PIL6.
    BgeeiQ6PIL6.
    CleanExiHS_KCNIP4.
    GenevestigatoriQ6PIL6.

    Organism-specific databases

    HPAiHPA022862.

    Interactioni

    Subunit structurei

    Component of heteromultimeric potassium channels By similarity. Interacts with KCND2. Interacts with KCND3, and the C-terminus of PSEN2 and probably PSEN1.By similarity1 Publication

    Protein-protein interaction databases

    BioGridi123244. 5 interactions.
    STRINGi9606.ENSP00000398943.

    Structurei

    3D structure databases

    ProteinModelPortaliQ6PIL6.
    SMRiQ6PIL6. Positions 53-250.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini61 – 11757EF-hand 1; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Domaini120 – 15536EF-hand 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini156 – 19136EF-hand 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini204 – 23936EF-hand 4PROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni2 – 4443KISBy similarityAdd
    BLAST
    Regioni237 – 25014Interaction with KCND2By similarityAdd
    BLAST

    Domaini

    The KIS (K-channel inactivation suppressor) domain is required for converting A-type Kv4 current to a slowly inactivating delayed rectifier potassium current.By similarity

    Sequence similaritiesi

    Belongs to the recoverin family.Curated
    Contains 4 EF-hand domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiCOG5126.
    HOGENOMiHOG000233019.
    HOVERGENiHBG108179.
    OMAiLVFASIK.
    OrthoDBiEOG7GJ6F3.
    PhylomeDBiQ6PIL6.
    TreeFamiTF318560.

    Family and domain databases

    Gene3Di1.10.238.10. 3 hits.
    InterProiIPR011992. EF-hand-dom_pair.
    IPR018247. EF_Hand_1_Ca_BS.
    IPR002048. EF_hand_dom.
    IPR028846. Recoverin.
    [Graphical view]
    PANTHERiPTHR23055. PTHR23055. 1 hit.
    PfamiPF13499. EF-hand_7. 1 hit.
    [Graphical view]
    SMARTiSM00054. EFh. 3 hits.
    [Graphical view]
    PROSITEiPS00018. EF_HAND_1. 3 hits.
    PS50222. EF_HAND_2. 3 hits.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6PIL6-1) [UniParc]FASTAAdd to Basket

    Also known as: KChIP4.1

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MNVRRVESIS AQLEEASSTG GFLYAQNSTK RSIKERLMKL LPCSAAKTSS    50
    PAIQNSVEDE LEMATVRHRP EALELLEAQS KFTKKELQIL YRGFKNECPS 100
    GVVNEETFKE IYSQFFPQGD STTYAHFLFN AFDTDHNGAV SFEDFIKGLS 150
    ILLRGTVQEK LNWAFNLYDI NKDGYITKEE MLDIMKAIYD MMGKCTYPVL 200
    KEDAPRQHVE TFFQKMDKNK DGVVTIDEFI ESCQKDENIM RSMQLFENVI 250
    Length:250
    Mass (Da):28,729
    Last modified:July 5, 2004 - v1
    Checksum:iDC6C758D73468092
    GO
    Isoform 2 (identifier: Q6PIL6-2) [UniParc]FASTAAdd to Basket

    Also known as: KChIP4.2

    The sequence of this isoform differs from the canonical sequence as follows:
         21-55: GFLYAQNSTKRSIKERLMKLLPCSAAKTSSPAIQN → D

    Show »
    Length:216
    Mass (Da):25,008
    Checksum:i17C4AFD3B4CFF23C
    GO
    Isoform 3 (identifier: Q6PIL6-3) [UniParc]FASTAAdd to Basket

    Also known as: KChIP4bs, KCHIP4.2

    The sequence of this isoform differs from the canonical sequence as follows:
         1-62: Missing.

    Show »
    Length:188
    Mass (Da):21,945
    Checksum:i9F46CA3A8A308410
    GO
    Isoform 4 (identifier: Q6PIL6-4) [UniParc]FASTAAdd to Basket

    Also known as: KChIP4.4

    The sequence of this isoform differs from the canonical sequence as follows:
         1-55: MNVRRVESIS...AKTSSPAIQN → MNLEGLEMIAVLIVIVLFVKLLEQFGLIEAGLED

    Show »
    Length:229
    Mass (Da):26,502
    Checksum:i08DF864F1A838BE8
    GO
    Isoform 5 (identifier: Q6PIL6-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-55: MNVRRVESIS...AKTSSPAIQN → MSGCRKRCKREILKFAQYLLRLLTGSLHTD

    Show »
    Length:225
    Mass (Da):26,267
    Checksum:iB140E66E43A89049
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti29 – 291T → I in AAG36974. (PubMed:11847232)Curated
    Sequence conflicti29 – 291T → I in AAK53713. 1 PublicationCurated
    Sequence conflicti32 – 321S → N in AAG36974. (PubMed:11847232)Curated
    Sequence conflicti32 – 321S → N in AAK53713. 1 PublicationCurated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 6262Missing in isoform 3. 3 PublicationsVSP_015066Add
    BLAST
    Alternative sequencei1 – 5555MNVRR…PAIQN → MNLEGLEMIAVLIVIVLFVK LLEQFGLIEAGLED in isoform 4. 2 PublicationsVSP_015067Add
    BLAST
    Alternative sequencei1 – 5555MNVRR…PAIQN → MSGCRKRCKREILKFAQYLL RLLTGSLHTD in isoform 5. 1 PublicationVSP_043321Add
    BLAST
    Alternative sequencei21 – 5535GFLYA…PAIQN → D in isoform 2. 3 PublicationsVSP_015068Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF302044 mRNA. Translation: AAG36974.1.
    AF305072 mRNA. Translation: AAG36977.1.
    AF453246 mRNA. Translation: AAL86769.1.
    AF367023 mRNA. Translation: AAK53712.1.
    AF367024 mRNA. Translation: AAK53713.1.
    AY029176 mRNA. Translation: AAK31594.1.
    AY118170 mRNA. Translation: AAM81578.1.
    DQ148487 mRNA. Translation: AAZ77804.1.
    DQ148488 mRNA. Translation: AAZ77805.1.
    DQ148489 mRNA. Translation: AAZ77806.1.
    DQ148490 mRNA. Translation: AAZ77807.1.
    DQ148491 mRNA. Translation: AAZ77808.1.
    AK289922 mRNA. Translation: BAF82611.1.
    AC096576 Genomic DNA. No translation available.
    AC097505 Genomic DNA. No translation available.
    AC098597 Genomic DNA. No translation available.
    AC104065 Genomic DNA. Translation: AAY40911.1.
    AC107462 Genomic DNA. No translation available.
    AC108147 Genomic DNA. No translation available.
    AC109360 Genomic DNA. No translation available.
    AC109636 Genomic DNA. No translation available.
    AC110296 Genomic DNA. No translation available.
    AC110612 Genomic DNA. No translation available.
    AC113606 Genomic DNA. No translation available.
    AC116641 Genomic DNA. No translation available.
    CH471069 Genomic DNA. Translation: EAW92798.1.
    BC032520 mRNA. Translation: AAH32520.1.
    CCDSiCCDS3428.1. [Q6PIL6-4]
    CCDS43215.1. [Q6PIL6-2]
    CCDS43216.1. [Q6PIL6-1]
    CCDS43217.1. [Q6PIL6-5]
    CCDS47035.1. [Q6PIL6-3]
    RefSeqiNP_001030175.1. NM_001035003.1. [Q6PIL6-5]
    NP_001030176.1. NM_001035004.1. [Q6PIL6-3]
    NP_079497.2. NM_025221.5. [Q6PIL6-1]
    NP_671710.1. NM_147181.3. [Q6PIL6-2]
    NP_671711.1. NM_147182.3. [Q6PIL6-3]
    NP_671712.1. NM_147183.3. [Q6PIL6-4]
    UniGeneiHs.655705.

    Genome annotation databases

    EnsembliENST00000359001; ENSP00000351892; ENSG00000185774. [Q6PIL6-3]
    ENST00000382148; ENSP00000371583; ENSG00000185774. [Q6PIL6-5]
    ENST00000382150; ENSP00000371585; ENSG00000185774. [Q6PIL6-4]
    ENST00000382152; ENSP00000371587; ENSG00000185774. [Q6PIL6-1]
    ENST00000447367; ENSP00000399080; ENSG00000185774. [Q6PIL6-2]
    ENST00000509207; ENSP00000423257; ENSG00000185774. [Q6PIL6-3]
    GeneIDi80333.
    KEGGihsa:80333.
    UCSCiuc003gqf.1. human. [Q6PIL6-4]
    uc003gqg.1. human. [Q6PIL6-1]
    uc003gqh.1. human. [Q6PIL6-5]
    uc021xmu.1. human. [Q6PIL6-2]

    Polymorphism databases

    DMDMi73621129.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF302044 mRNA. Translation: AAG36974.1 .
    AF305072 mRNA. Translation: AAG36977.1 .
    AF453246 mRNA. Translation: AAL86769.1 .
    AF367023 mRNA. Translation: AAK53712.1 .
    AF367024 mRNA. Translation: AAK53713.1 .
    AY029176 mRNA. Translation: AAK31594.1 .
    AY118170 mRNA. Translation: AAM81578.1 .
    DQ148487 mRNA. Translation: AAZ77804.1 .
    DQ148488 mRNA. Translation: AAZ77805.1 .
    DQ148489 mRNA. Translation: AAZ77806.1 .
    DQ148490 mRNA. Translation: AAZ77807.1 .
    DQ148491 mRNA. Translation: AAZ77808.1 .
    AK289922 mRNA. Translation: BAF82611.1 .
    AC096576 Genomic DNA. No translation available.
    AC097505 Genomic DNA. No translation available.
    AC098597 Genomic DNA. No translation available.
    AC104065 Genomic DNA. Translation: AAY40911.1 .
    AC107462 Genomic DNA. No translation available.
    AC108147 Genomic DNA. No translation available.
    AC109360 Genomic DNA. No translation available.
    AC109636 Genomic DNA. No translation available.
    AC110296 Genomic DNA. No translation available.
    AC110612 Genomic DNA. No translation available.
    AC113606 Genomic DNA. No translation available.
    AC116641 Genomic DNA. No translation available.
    CH471069 Genomic DNA. Translation: EAW92798.1 .
    BC032520 mRNA. Translation: AAH32520.1 .
    CCDSi CCDS3428.1. [Q6PIL6-4 ]
    CCDS43215.1. [Q6PIL6-2 ]
    CCDS43216.1. [Q6PIL6-1 ]
    CCDS43217.1. [Q6PIL6-5 ]
    CCDS47035.1. [Q6PIL6-3 ]
    RefSeqi NP_001030175.1. NM_001035003.1. [Q6PIL6-5 ]
    NP_001030176.1. NM_001035004.1. [Q6PIL6-3 ]
    NP_079497.2. NM_025221.5. [Q6PIL6-1 ]
    NP_671710.1. NM_147181.3. [Q6PIL6-2 ]
    NP_671711.1. NM_147182.3. [Q6PIL6-3 ]
    NP_671712.1. NM_147183.3. [Q6PIL6-4 ]
    UniGenei Hs.655705.

    3D structure databases

    ProteinModelPortali Q6PIL6.
    SMRi Q6PIL6. Positions 53-250.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 123244. 5 interactions.
    STRINGi 9606.ENSP00000398943.

    Protein family/group databases

    TCDBi 5.B.1.1.7. the phagocyte (gp91(phox)) nadph oxidase family.

    PTM databases

    PhosphoSitei Q6PIL6.

    Polymorphism databases

    DMDMi 73621129.

    Proteomic databases

    PaxDbi Q6PIL6.
    PRIDEi Q6PIL6.

    Protocols and materials databases

    DNASUi 80333.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000359001 ; ENSP00000351892 ; ENSG00000185774 . [Q6PIL6-3 ]
    ENST00000382148 ; ENSP00000371583 ; ENSG00000185774 . [Q6PIL6-5 ]
    ENST00000382150 ; ENSP00000371585 ; ENSG00000185774 . [Q6PIL6-4 ]
    ENST00000382152 ; ENSP00000371587 ; ENSG00000185774 . [Q6PIL6-1 ]
    ENST00000447367 ; ENSP00000399080 ; ENSG00000185774 . [Q6PIL6-2 ]
    ENST00000509207 ; ENSP00000423257 ; ENSG00000185774 . [Q6PIL6-3 ]
    GeneIDi 80333.
    KEGGi hsa:80333.
    UCSCi uc003gqf.1. human. [Q6PIL6-4 ]
    uc003gqg.1. human. [Q6PIL6-1 ]
    uc003gqh.1. human. [Q6PIL6-5 ]
    uc021xmu.1. human. [Q6PIL6-2 ]

    Organism-specific databases

    CTDi 80333.
    GeneCardsi GC04M020814.
    H-InvDB HIX0120159.
    HGNCi HGNC:30083. KCNIP4.
    HPAi HPA022862.
    MIMi 608182. gene.
    neXtProti NX_Q6PIL6.
    PharmGKBi PA134893552.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5126.
    HOGENOMi HOG000233019.
    HOVERGENi HBG108179.
    OMAi LVFASIK.
    OrthoDBi EOG7GJ6F3.
    PhylomeDBi Q6PIL6.
    TreeFami TF318560.

    Miscellaneous databases

    ChiTaRSi KCNIP4. human.
    GenomeRNAii 80333.
    NextBioi 70886.
    PROi Q6PIL6.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q6PIL6.
    Bgeei Q6PIL6.
    CleanExi HS_KCNIP4.
    Genevestigatori Q6PIL6.

    Family and domain databases

    Gene3Di 1.10.238.10. 3 hits.
    InterProi IPR011992. EF-hand-dom_pair.
    IPR018247. EF_Hand_1_Ca_BS.
    IPR002048. EF_hand_dom.
    IPR028846. Recoverin.
    [Graphical view ]
    PANTHERi PTHR23055. PTHR23055. 1 hit.
    Pfami PF13499. EF-hand_7. 1 hit.
    [Graphical view ]
    SMARTi SM00054. EFh. 3 hits.
    [Graphical view ]
    PROSITEi PS00018. EF_HAND_1. 3 hits.
    PS50222. EF_HAND_2. 3 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning and characterization of CALP/KChIP4, a novel EF-hand protein interacting with presenilin 2 and voltage-gated potassium channel subunit Kv4."
      Morohashi Y., Hatano N., Ohya S., Takikawa R., Watabiki T., Takasugi N., Imaizumi Y., Tomita T., Iwatsubo T.
      J. Biol. Chem. 277:14965-14975(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH KCND2; PSEN1 AND PSEN2.
    2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
    3. Isbrandt D., Pongs O.
      Submitted (MAR-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4).
    4. "Structure, alternative splicing, and expression of the human and mouse KCNIP gene family."
      Pruunsild P., Timmusk T.
      Genomics 86:581-593(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4 AND 5), ALTERNATIVE SPLICING.
    5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Hippocampus.
    6. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Eye.

    Entry informationi

    Entry nameiKCIP4_HUMAN
    AccessioniPrimary (citable) accession number: Q6PIL6
    Secondary accession number(s): Q3YAB8
    , Q3YAB9, Q3YAC0, Q3YAC1, Q3YAC2, Q4W5G8, Q8NEU0, Q9BWT2, Q9H294, Q9H2A4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 16, 2005
    Last sequence update: July 5, 2004
    Last modified: October 1, 2014
    This is version 99 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 4
      Human chromosome 4: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3