Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kv channel-interacting protein 4

Gene

KCNIP4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Modulates KCND2 channel density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner (PubMed:11847232, PubMed:18957440, PubMed:23576435). Modulates KCND3/Kv4.3 currents (PubMed:23576435). Isoform 4 does not increase KCND2 expression at the cell membrane (PubMed:18957440). Isoform 4 retains KCND3 in the endoplasmic reticulum and negatively regulates its expression at the cell membrane.By similarity3 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Calcium bindingi133 – 1441PROSITE-ProRule annotationAdd BLAST12
Calcium bindingi169 – 1802PROSITE-ProRule annotationAdd BLAST12
Calcium bindingi217 – 2283PROSITE-ProRule annotationAdd BLAST12

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionIon channel, Potassium channel, Voltage-gated channel
Biological processIon transport, Potassium transport, Transport
LigandCalcium, Metal-binding, Potassium

Enzyme and pathway databases

ReactomeiR-HSA-5576894 Phase 1 - inactivation of fast Na+ channels

Protein family/group databases

TCDBi8.A.82.2.2 the calmodulin calcium binding protein (calmodulin) family

Names & Taxonomyi

Protein namesi
Recommended name:
Kv channel-interacting protein 4
Short name:
KChIP41 Publication
Alternative name(s):
A-type potassium channel modulatory protein 4
Calsenilin-like protein1 Publication
Potassium channel-interacting protein 4
Gene namesi
Name:KCNIP4
Synonyms:CALP, KCHIP4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

EuPathDBiHostDB:ENSG00000185774.14
HGNCiHGNC:30083 KCNIP4
MIMi608182 gene
neXtProtiNX_Q6PIL6

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Endoplasmic reticulum, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi80333
OpenTargetsiENSG00000185774
PharmGKBiPA134893552

Polymorphism and mutation databases

BioMutaiKCNIP4
DMDMi73621129

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000738251 – 250Kv channel-interacting protein 4Add BLAST250

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei17PhosphoserineBy similarity1
Modified residuei56PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ6PIL6
PaxDbiQ6PIL6
PeptideAtlasiQ6PIL6
PRIDEiQ6PIL6

PTM databases

iPTMnetiQ6PIL6
PhosphoSitePlusiQ6PIL6

Expressioni

Tissue specificityi

Predominantly expressed in brain.1 Publication

Gene expression databases

BgeeiENSG00000185774
CleanExiHS_KCNIP4
ExpressionAtlasiQ6PIL6 baseline and differential
GenevisibleiQ6PIL6 HS

Organism-specific databases

HPAiHPA022862
HPA066717

Interactioni

Subunit structurei

Component of heteromultimeric potassium channels (PubMed:23576435). Identified in potassium channel complexes containing KCND1, KCND2, KCND3, KCNIP1, KCNIP2, KCNIP3, KCNIP4, DPP6 and DPP10 (By similarity). Interacts with KCND2 (PubMed:11847232, PubMed:18957440). Interacts with KCND3 (By similarity). Interacts with the C-terminus of PSEN2 and probably PSEN1 (PubMed:11847232).By similarity4 Publications

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi12324415 interactors.
CORUMiQ6PIL6
IntActiQ6PIL6 7 interactors.
STRINGi9606.ENSP00000371587

Structurei

3D structure databases

ProteinModelPortaliQ6PIL6
SMRiQ6PIL6
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini61 – 117EF-hand 1; degeneratePROSITE-ProRule annotationAdd BLAST57
Domaini120 – 155EF-hand 2PROSITE-ProRule annotationAdd BLAST36
Domaini156 – 191EF-hand 3PROSITE-ProRule annotationAdd BLAST36
Domaini204 – 239EF-hand 4PROSITE-ProRule annotationAdd BLAST36

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni2 – 44KISBy similarityAdd BLAST43
Regioni237 – 250Interaction with KCND2By similarityAdd BLAST14

Domaini

The KIS (K-channel inactivation suppressor) domain is required for converting A-type Kv4 current to a slowly inactivating delayed rectifier potassium current.By similarity

Sequence similaritiesi

Belongs to the recoverin family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0044 Eukaryota
COG5126 LUCA
GeneTreeiENSGT00760000118820
HOGENOMiHOG000233019
HOVERGENiHBG108179
InParanoidiQ6PIL6
OMAiDTVEDEM
OrthoDBiEOG091G11T4
PhylomeDBiQ6PIL6
TreeFamiTF318560

Family and domain databases

CDDicd00051 EFh, 2 hits
InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom
PfamiView protein in Pfam
PF13499 EF-hand_7, 1 hit
PF13833 EF-hand_8, 1 hit
SMARTiView protein in SMART
SM00054 EFh, 3 hits
SUPFAMiSSF47473 SSF47473, 1 hit
PROSITEiView protein in PROSITE
PS00018 EF_HAND_1, 3 hits
PS50222 EF_HAND_2, 3 hits

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6PIL6-1) [UniParc]FASTAAdd to basket
Also known as: KChIP4.1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNVRRVESIS AQLEEASSTG GFLYAQNSTK RSIKERLMKL LPCSAAKTSS
60 70 80 90 100
PAIQNSVEDE LEMATVRHRP EALELLEAQS KFTKKELQIL YRGFKNECPS
110 120 130 140 150
GVVNEETFKE IYSQFFPQGD STTYAHFLFN AFDTDHNGAV SFEDFIKGLS
160 170 180 190 200
ILLRGTVQEK LNWAFNLYDI NKDGYITKEE MLDIMKAIYD MMGKCTYPVL
210 220 230 240 250
KEDAPRQHVE TFFQKMDKNK DGVVTIDEFI ESCQKDENIM RSMQLFENVI
Length:250
Mass (Da):28,729
Last modified:July 5, 2004 - v1
Checksum:iDC6C758D73468092
GO
Isoform 2 (identifier: Q6PIL6-2) [UniParc]FASTAAdd to basket
Also known as: KChIP4.2

The sequence of this isoform differs from the canonical sequence as follows:
     21-55: GFLYAQNSTKRSIKERLMKLLPCSAAKTSSPAIQN → D

Show »
Length:216
Mass (Da):25,008
Checksum:i17C4AFD3B4CFF23C
GO
Isoform 3 (identifier: Q6PIL6-3) [UniParc]FASTAAdd to basket
Also known as: KChIP4bs, KCHIP4.2

The sequence of this isoform differs from the canonical sequence as follows:
     1-62: Missing.

Show »
Length:188
Mass (Da):21,945
Checksum:i9F46CA3A8A308410
GO
Isoform 4 (identifier: Q6PIL6-4) [UniParc]FASTAAdd to basket
Also known as: KChIP4a, KChIP4.4

The sequence of this isoform differs from the canonical sequence as follows:
     1-55: MNVRRVESIS...AKTSSPAIQN → MNLEGLEMIAVLIVIVLFVKLLEQFGLIEAGLED

Show »
Length:229
Mass (Da):26,502
Checksum:i08DF864F1A838BE8
GO
Isoform 5 (identifier: Q6PIL6-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-55: MNVRRVESIS...AKTSSPAIQN → MSGCRKRCKREILKFAQYLLRLLTGSLHTD

Show »
Length:225
Mass (Da):26,267
Checksum:iB140E66E43A89049
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti29T → I in AAG36974 (PubMed:11847232).Curated1
Sequence conflicti29T → I in AAK53713 (Ref. 3) Curated1
Sequence conflicti32S → N in AAG36974 (PubMed:11847232).Curated1
Sequence conflicti32S → N in AAK53713 (Ref. 3) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0150661 – 62Missing in isoform 3. 3 PublicationsAdd BLAST62
Alternative sequenceiVSP_0150671 – 55MNVRR…PAIQN → MNLEGLEMIAVLIVIVLFVK LLEQFGLIEAGLED in isoform 4. 2 PublicationsAdd BLAST55
Alternative sequenceiVSP_0433211 – 55MNVRR…PAIQN → MSGCRKRCKREILKFAQYLL RLLTGSLHTD in isoform 5. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_01506821 – 55GFLYA…PAIQN → D in isoform 2. 3 PublicationsAdd BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF302044 mRNA Translation: AAG36974.1
AF305072 mRNA Translation: AAG36977.1
AF453246 mRNA Translation: AAL86769.1
AF367023 mRNA Translation: AAK53712.1
AF367024 mRNA Translation: AAK53713.1
AY029176 mRNA Translation: AAK31594.1
AY118170 mRNA Translation: AAM81578.1
DQ148487 mRNA Translation: AAZ77804.1
DQ148488 mRNA Translation: AAZ77805.1
DQ148489 mRNA Translation: AAZ77806.1
DQ148490 mRNA Translation: AAZ77807.1
DQ148491 mRNA Translation: AAZ77808.1
AK289922 mRNA Translation: BAF82611.1
AC096576 Genomic DNA No translation available.
AC097505 Genomic DNA No translation available.
AC098597 Genomic DNA No translation available.
AC104065 Genomic DNA Translation: AAY40911.1
AC107462 Genomic DNA No translation available.
AC108147 Genomic DNA No translation available.
AC109360 Genomic DNA No translation available.
AC109636 Genomic DNA No translation available.
AC110296 Genomic DNA No translation available.
AC110612 Genomic DNA No translation available.
AC113606 Genomic DNA No translation available.
AC116641 Genomic DNA No translation available.
CH471069 Genomic DNA Translation: EAW92798.1
BC032520 mRNA Translation: AAH32520.1
CCDSiCCDS3428.1 [Q6PIL6-4]
CCDS43215.1 [Q6PIL6-2]
CCDS43216.1 [Q6PIL6-1]
CCDS43217.1 [Q6PIL6-5]
CCDS47035.1 [Q6PIL6-3]
RefSeqiNP_001030175.1, NM_001035003.1 [Q6PIL6-5]
NP_001030176.1, NM_001035004.1 [Q6PIL6-3]
NP_079497.2, NM_025221.5 [Q6PIL6-1]
NP_671710.1, NM_147181.3 [Q6PIL6-2]
NP_671711.1, NM_147182.3 [Q6PIL6-3]
NP_671712.1, NM_147183.3 [Q6PIL6-4]
XP_016864142.1, XM_017008653.1 [Q6PIL6-3]
UniGeneiHs.655705

Genome annotation databases

EnsembliENST00000359001; ENSP00000351892; ENSG00000185774 [Q6PIL6-3]
ENST00000382148; ENSP00000371583; ENSG00000185774 [Q6PIL6-5]
ENST00000382150; ENSP00000371585; ENSG00000185774 [Q6PIL6-4]
ENST00000382152; ENSP00000371587; ENSG00000185774 [Q6PIL6-1]
ENST00000447367; ENSP00000399080; ENSG00000185774 [Q6PIL6-2]
ENST00000509207; ENSP00000423257; ENSG00000185774 [Q6PIL6-3]
GeneIDi80333
KEGGihsa:80333
UCSCiuc003gqf.2 human [Q6PIL6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiKCIP4_HUMAN
AccessioniPrimary (citable) accession number: Q6PIL6
Secondary accession number(s): Q3YAB8
, Q3YAB9, Q3YAC0, Q3YAC1, Q3YAC2, Q4W5G8, Q8NEU0, Q9BWT2, Q9H294, Q9H2A4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 16, 2005
Last sequence update: July 5, 2004
Last modified: March 28, 2018
This is version 130 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome