Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kv channel-interacting protein 4

Gene

KCNIP4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Modulates KCND2 channel density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner (PubMed:11847232, PubMed:18957440, PubMed:23576435). Modulates KCND3/Kv4.3 currents (PubMed:23576435). Isoform 4 does not increase KCND2 expression at the cell membrane (PubMed:18957440). Isoform 4 retains KCND3 in the endoplasmic reticulum and negatively regulates its expression at the cell membrane.By similarity3 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Calcium bindingi133 – 1441PROSITE-ProRule annotationAdd BLAST12
Calcium bindingi169 – 1802PROSITE-ProRule annotationAdd BLAST12
Calcium bindingi217 – 2283PROSITE-ProRule annotationAdd BLAST12

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Ion channel, Potassium channel, Voltage-gated channel

Keywords - Biological processi

Ion transport, Potassium transport, Transport

Keywords - Ligandi

Calcium, Metal-binding, Potassium

Enzyme and pathway databases

BioCyciZFISH:G66-32335-MONOMER.
ReactomeiR-HSA-5576894. Phase 1 - inactivation of fast Na+ channels.

Protein family/group databases

TCDBi5.B.1.2.2. the phagocyte (gp91(phox)) nadph oxidase family.

Names & Taxonomyi

Protein namesi
Recommended name:
Kv channel-interacting protein 4
Short name:
KChIP41 Publication
Alternative name(s):
A-type potassium channel modulatory protein 4
Calsenilin-like protein1 Publication
Potassium channel-interacting protein 4
Gene namesi
Name:KCNIP4
Synonyms:CALP, KCHIP4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:30083. KCNIP4.

Subcellular locationi

Isoform 4 :

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • cytosol Source: UniProtKB
  • endoplasmic reticulum Source: UniProtKB-SubCell
  • plasma membrane Source: UniProtKB
  • voltage-gated potassium channel complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Endoplasmic reticulum, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi80333.
OpenTargetsiENSG00000185774.
PharmGKBiPA134893552.

Polymorphism and mutation databases

BioMutaiKCNIP4.
DMDMi73621129.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000738251 – 250Kv channel-interacting protein 4Add BLAST250

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei17PhosphoserineBy similarity1
Modified residuei56PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ6PIL6.
PaxDbiQ6PIL6.
PeptideAtlasiQ6PIL6.
PRIDEiQ6PIL6.

PTM databases

iPTMnetiQ6PIL6.
PhosphoSitePlusiQ6PIL6.

Expressioni

Tissue specificityi

Predominantly expressed in brain.1 Publication

Gene expression databases

BgeeiENSG00000185774.
CleanExiHS_KCNIP4.
ExpressionAtlasiQ6PIL6. baseline and differential.
GenevisibleiQ6PIL6. HS.

Organism-specific databases

HPAiHPA022862.

Interactioni

Subunit structurei

Component of heteromultimeric potassium channels (PubMed:23576435). Identified in potassium channel complexes containing KCND1, KCND2, KCND3, KCNIP1, KCNIP2, KCNIP3, KCNIP4, DPP6 and DPP10 (By similarity). Interacts with KCND2 (PubMed:11847232, PubMed:18957440). Interacts with KCND3 (By similarity). Interacts with the C-terminus of PSEN2 and probably PSEN1 (PubMed:11847232).By similarity4 Publications

Protein-protein interaction databases

BioGridi123244. 15 interactors.
IntActiQ6PIL6. 1 interactor.
STRINGi9606.ENSP00000371587.

Structurei

3D structure databases

ProteinModelPortaliQ6PIL6.
SMRiQ6PIL6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini61 – 117EF-hand 1; degeneratePROSITE-ProRule annotationAdd BLAST57
Domaini120 – 155EF-hand 2PROSITE-ProRule annotationAdd BLAST36
Domaini156 – 191EF-hand 3PROSITE-ProRule annotationAdd BLAST36
Domaini204 – 239EF-hand 4PROSITE-ProRule annotationAdd BLAST36

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni2 – 44KISBy similarityAdd BLAST43
Regioni237 – 250Interaction with KCND2By similarityAdd BLAST14

Domaini

The KIS (K-channel inactivation suppressor) domain is required for converting A-type Kv4 current to a slowly inactivating delayed rectifier potassium current.By similarity

Sequence similaritiesi

Belongs to the recoverin family.Curated
Contains 4 EF-hand domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0044. Eukaryota.
COG5126. LUCA.
GeneTreeiENSGT00760000118820.
HOGENOMiHOG000233019.
HOVERGENiHBG108179.
InParanoidiQ6PIL6.
OMAiDTVEDEM.
OrthoDBiEOG091G11T4.
PhylomeDBiQ6PIL6.
TreeFamiTF318560.

Family and domain databases

CDDicd00051. EFh. 2 hits.
Gene3Di1.10.238.10. 3 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR028846. Recoverin.
[Graphical view]
PANTHERiPTHR23055. PTHR23055. 1 hit.
PfamiPF13499. EF-hand_7. 1 hit.
PF13833. EF-hand_8. 1 hit.
[Graphical view]
SMARTiSM00054. EFh. 3 hits.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
PROSITEiPS00018. EF_HAND_1. 3 hits.
PS50222. EF_HAND_2. 3 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6PIL6-1) [UniParc]FASTAAdd to basket
Also known as: KChIP4.1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNVRRVESIS AQLEEASSTG GFLYAQNSTK RSIKERLMKL LPCSAAKTSS
60 70 80 90 100
PAIQNSVEDE LEMATVRHRP EALELLEAQS KFTKKELQIL YRGFKNECPS
110 120 130 140 150
GVVNEETFKE IYSQFFPQGD STTYAHFLFN AFDTDHNGAV SFEDFIKGLS
160 170 180 190 200
ILLRGTVQEK LNWAFNLYDI NKDGYITKEE MLDIMKAIYD MMGKCTYPVL
210 220 230 240 250
KEDAPRQHVE TFFQKMDKNK DGVVTIDEFI ESCQKDENIM RSMQLFENVI
Length:250
Mass (Da):28,729
Last modified:July 5, 2004 - v1
Checksum:iDC6C758D73468092
GO
Isoform 2 (identifier: Q6PIL6-2) [UniParc]FASTAAdd to basket
Also known as: KChIP4.2

The sequence of this isoform differs from the canonical sequence as follows:
     21-55: GFLYAQNSTKRSIKERLMKLLPCSAAKTSSPAIQN → D

Show »
Length:216
Mass (Da):25,008
Checksum:i17C4AFD3B4CFF23C
GO
Isoform 3 (identifier: Q6PIL6-3) [UniParc]FASTAAdd to basket
Also known as: KChIP4bs, KCHIP4.2

The sequence of this isoform differs from the canonical sequence as follows:
     1-62: Missing.

Show »
Length:188
Mass (Da):21,945
Checksum:i9F46CA3A8A308410
GO
Isoform 4 (identifier: Q6PIL6-4) [UniParc]FASTAAdd to basket
Also known as: KChIP4a, KChIP4.4

The sequence of this isoform differs from the canonical sequence as follows:
     1-55: MNVRRVESIS...AKTSSPAIQN → MNLEGLEMIAVLIVIVLFVKLLEQFGLIEAGLED

Show »
Length:229
Mass (Da):26,502
Checksum:i08DF864F1A838BE8
GO
Isoform 5 (identifier: Q6PIL6-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-55: MNVRRVESIS...AKTSSPAIQN → MSGCRKRCKREILKFAQYLLRLLTGSLHTD

Show »
Length:225
Mass (Da):26,267
Checksum:iB140E66E43A89049
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti29T → I in AAG36974 (PubMed:11847232).Curated1
Sequence conflicti29T → I in AAK53713 (Ref. 3) Curated1
Sequence conflicti32S → N in AAG36974 (PubMed:11847232).Curated1
Sequence conflicti32S → N in AAK53713 (Ref. 3) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0150661 – 62Missing in isoform 3. 3 PublicationsAdd BLAST62
Alternative sequenceiVSP_0150671 – 55MNVRR…PAIQN → MNLEGLEMIAVLIVIVLFVK LLEQFGLIEAGLED in isoform 4. 2 PublicationsAdd BLAST55
Alternative sequenceiVSP_0433211 – 55MNVRR…PAIQN → MSGCRKRCKREILKFAQYLL RLLTGSLHTD in isoform 5. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_01506821 – 55GFLYA…PAIQN → D in isoform 2. 3 PublicationsAdd BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF302044 mRNA. Translation: AAG36974.1.
AF305072 mRNA. Translation: AAG36977.1.
AF453246 mRNA. Translation: AAL86769.1.
AF367023 mRNA. Translation: AAK53712.1.
AF367024 mRNA. Translation: AAK53713.1.
AY029176 mRNA. Translation: AAK31594.1.
AY118170 mRNA. Translation: AAM81578.1.
DQ148487 mRNA. Translation: AAZ77804.1.
DQ148488 mRNA. Translation: AAZ77805.1.
DQ148489 mRNA. Translation: AAZ77806.1.
DQ148490 mRNA. Translation: AAZ77807.1.
DQ148491 mRNA. Translation: AAZ77808.1.
AK289922 mRNA. Translation: BAF82611.1.
AC096576 Genomic DNA. No translation available.
AC097505 Genomic DNA. No translation available.
AC098597 Genomic DNA. No translation available.
AC104065 Genomic DNA. Translation: AAY40911.1.
AC107462 Genomic DNA. No translation available.
AC108147 Genomic DNA. No translation available.
AC109360 Genomic DNA. No translation available.
AC109636 Genomic DNA. No translation available.
AC110296 Genomic DNA. No translation available.
AC110612 Genomic DNA. No translation available.
AC113606 Genomic DNA. No translation available.
AC116641 Genomic DNA. No translation available.
CH471069 Genomic DNA. Translation: EAW92798.1.
BC032520 mRNA. Translation: AAH32520.1.
CCDSiCCDS3428.1. [Q6PIL6-4]
CCDS43215.1. [Q6PIL6-2]
CCDS43216.1. [Q6PIL6-1]
CCDS43217.1. [Q6PIL6-5]
CCDS47035.1. [Q6PIL6-3]
RefSeqiNP_001030175.1. NM_001035003.1. [Q6PIL6-5]
NP_001030176.1. NM_001035004.1. [Q6PIL6-3]
NP_079497.2. NM_025221.5. [Q6PIL6-1]
NP_671710.1. NM_147181.3. [Q6PIL6-2]
NP_671711.1. NM_147182.3. [Q6PIL6-3]
NP_671712.1. NM_147183.3. [Q6PIL6-4]
XP_016864142.1. XM_017008653.1. [Q6PIL6-3]
UniGeneiHs.655705.

Genome annotation databases

EnsembliENST00000359001; ENSP00000351892; ENSG00000185774. [Q6PIL6-3]
ENST00000382148; ENSP00000371583; ENSG00000185774. [Q6PIL6-5]
ENST00000382150; ENSP00000371585; ENSG00000185774. [Q6PIL6-4]
ENST00000382152; ENSP00000371587; ENSG00000185774. [Q6PIL6-1]
ENST00000447367; ENSP00000399080; ENSG00000185774. [Q6PIL6-2]
ENST00000509207; ENSP00000423257; ENSG00000185774. [Q6PIL6-3]
GeneIDi80333.
KEGGihsa:80333.
UCSCiuc003gqf.2. human. [Q6PIL6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF302044 mRNA. Translation: AAG36974.1.
AF305072 mRNA. Translation: AAG36977.1.
AF453246 mRNA. Translation: AAL86769.1.
AF367023 mRNA. Translation: AAK53712.1.
AF367024 mRNA. Translation: AAK53713.1.
AY029176 mRNA. Translation: AAK31594.1.
AY118170 mRNA. Translation: AAM81578.1.
DQ148487 mRNA. Translation: AAZ77804.1.
DQ148488 mRNA. Translation: AAZ77805.1.
DQ148489 mRNA. Translation: AAZ77806.1.
DQ148490 mRNA. Translation: AAZ77807.1.
DQ148491 mRNA. Translation: AAZ77808.1.
AK289922 mRNA. Translation: BAF82611.1.
AC096576 Genomic DNA. No translation available.
AC097505 Genomic DNA. No translation available.
AC098597 Genomic DNA. No translation available.
AC104065 Genomic DNA. Translation: AAY40911.1.
AC107462 Genomic DNA. No translation available.
AC108147 Genomic DNA. No translation available.
AC109360 Genomic DNA. No translation available.
AC109636 Genomic DNA. No translation available.
AC110296 Genomic DNA. No translation available.
AC110612 Genomic DNA. No translation available.
AC113606 Genomic DNA. No translation available.
AC116641 Genomic DNA. No translation available.
CH471069 Genomic DNA. Translation: EAW92798.1.
BC032520 mRNA. Translation: AAH32520.1.
CCDSiCCDS3428.1. [Q6PIL6-4]
CCDS43215.1. [Q6PIL6-2]
CCDS43216.1. [Q6PIL6-1]
CCDS43217.1. [Q6PIL6-5]
CCDS47035.1. [Q6PIL6-3]
RefSeqiNP_001030175.1. NM_001035003.1. [Q6PIL6-5]
NP_001030176.1. NM_001035004.1. [Q6PIL6-3]
NP_079497.2. NM_025221.5. [Q6PIL6-1]
NP_671710.1. NM_147181.3. [Q6PIL6-2]
NP_671711.1. NM_147182.3. [Q6PIL6-3]
NP_671712.1. NM_147183.3. [Q6PIL6-4]
XP_016864142.1. XM_017008653.1. [Q6PIL6-3]
UniGeneiHs.655705.

3D structure databases

ProteinModelPortaliQ6PIL6.
SMRiQ6PIL6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123244. 15 interactors.
IntActiQ6PIL6. 1 interactor.
STRINGi9606.ENSP00000371587.

Protein family/group databases

TCDBi5.B.1.2.2. the phagocyte (gp91(phox)) nadph oxidase family.

PTM databases

iPTMnetiQ6PIL6.
PhosphoSitePlusiQ6PIL6.

Polymorphism and mutation databases

BioMutaiKCNIP4.
DMDMi73621129.

Proteomic databases

EPDiQ6PIL6.
PaxDbiQ6PIL6.
PeptideAtlasiQ6PIL6.
PRIDEiQ6PIL6.

Protocols and materials databases

DNASUi80333.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000359001; ENSP00000351892; ENSG00000185774. [Q6PIL6-3]
ENST00000382148; ENSP00000371583; ENSG00000185774. [Q6PIL6-5]
ENST00000382150; ENSP00000371585; ENSG00000185774. [Q6PIL6-4]
ENST00000382152; ENSP00000371587; ENSG00000185774. [Q6PIL6-1]
ENST00000447367; ENSP00000399080; ENSG00000185774. [Q6PIL6-2]
ENST00000509207; ENSP00000423257; ENSG00000185774. [Q6PIL6-3]
GeneIDi80333.
KEGGihsa:80333.
UCSCiuc003gqf.2. human. [Q6PIL6-1]

Organism-specific databases

CTDi80333.
DisGeNETi80333.
GeneCardsiKCNIP4.
H-InvDBHIX0120159.
HGNCiHGNC:30083. KCNIP4.
HPAiHPA022862.
MIMi608182. gene.
neXtProtiNX_Q6PIL6.
OpenTargetsiENSG00000185774.
PharmGKBiPA134893552.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0044. Eukaryota.
COG5126. LUCA.
GeneTreeiENSGT00760000118820.
HOGENOMiHOG000233019.
HOVERGENiHBG108179.
InParanoidiQ6PIL6.
OMAiDTVEDEM.
OrthoDBiEOG091G11T4.
PhylomeDBiQ6PIL6.
TreeFamiTF318560.

Enzyme and pathway databases

BioCyciZFISH:G66-32335-MONOMER.
ReactomeiR-HSA-5576894. Phase 1 - inactivation of fast Na+ channels.

Miscellaneous databases

ChiTaRSiKCNIP4. human.
GenomeRNAii80333.
PROiQ6PIL6.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000185774.
CleanExiHS_KCNIP4.
ExpressionAtlasiQ6PIL6. baseline and differential.
GenevisibleiQ6PIL6. HS.

Family and domain databases

CDDicd00051. EFh. 2 hits.
Gene3Di1.10.238.10. 3 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR028846. Recoverin.
[Graphical view]
PANTHERiPTHR23055. PTHR23055. 1 hit.
PfamiPF13499. EF-hand_7. 1 hit.
PF13833. EF-hand_8. 1 hit.
[Graphical view]
SMARTiSM00054. EFh. 3 hits.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
PROSITEiPS00018. EF_HAND_1. 3 hits.
PS50222. EF_HAND_2. 3 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiKCIP4_HUMAN
AccessioniPrimary (citable) accession number: Q6PIL6
Secondary accession number(s): Q3YAB8
, Q3YAB9, Q3YAC0, Q3YAC1, Q3YAC2, Q4W5G8, Q8NEU0, Q9BWT2, Q9H294, Q9H2A4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 16, 2005
Last sequence update: July 5, 2004
Last modified: November 30, 2016
This is version 121 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.