Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein SHQ1 homolog

Gene

SHQ1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Required for the quantitative accumulation of H/ACA ribonucleoproteins (RNPs), including telomerase, probably through the stabilization of DKC1, from the time of its synthesis until its association with NOP10, NHP2, and NAF1 at the nascent H/ACA RNA.1 Publication

GO - Molecular functioni

GO - Biological processi

  • box H/ACA snoRNP assembly Source: GO_Central
  • negative regulation of rRNA processing Source: MGI
  • positive regulation of apoptotic process Source: MGI
  • positive regulation of telomerase RNA localization to Cajal body Source: BHF-UCL
  • ribonucleoprotein complex assembly Source: UniProtKB
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Protein SHQ1 homolog
Gene namesi
Name:SHQ1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:25543. SHQ1.

Subcellular locationi

  • Cytoplasmcytosol 1 Publication
  • Nucleusnucleoplasm 1 Publication

  • Note: May at least partially shuttle between cytosol and nucleoplasm. In the nucleoplasm, exhibits a granular pattern, but is excluded from nucleoli and Cajal bodies. Absent from most H/ACA-box RNA transcription sites.

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • cytosol Source: UniProtKB-SubCell
  • nucleoplasm Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi55164.
OpenTargetsiENSG00000144736.
PharmGKBiPA142670921.

Polymorphism and mutation databases

BioMutaiSHQ1.
DMDMi158563966.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003028221 – 577Protein SHQ1 homologAdd BLAST577

Proteomic databases

EPDiQ6PI26.
MaxQBiQ6PI26.
PaxDbiQ6PI26.
PeptideAtlasiQ6PI26.
PRIDEiQ6PI26.

PTM databases

iPTMnetiQ6PI26.
PhosphoSitePlusiQ6PI26.

Expressioni

Gene expression databases

BgeeiENSG00000144736.
CleanExiHS_SHQ1.
ExpressionAtlasiQ6PI26. baseline and differential.
GenevisibleiQ6PI26. HS.

Organism-specific databases

HPAiHPA042792.

Interactioni

Subunit structurei

Directly interacts with DKC1 alone, but not in the context of the core trimer composed of DKC1, NOP10 and NHP2, nor in the presence of NAF1. Does not interact with NAF1.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
FLJ13057Q53SE73EBI-2515568,EBI-10172181
GMCL1P1Q8NEA93EBI-2515568,EBI-745707

GO - Molecular functioni

Protein-protein interaction databases

BioGridi120464. 14 interactors.
IntActiQ6PI26. 7 interactors.
STRINGi9606.ENSP00000315182.

Structurei

Secondary structure

1577
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi6 – 10Combined sources5
Beta strandi12 – 20Combined sources9
Beta strandi26 – 28Combined sources3
Beta strandi30 – 42Combined sources13
Beta strandi45 – 55Combined sources11
Beta strandi62 – 66Combined sources5
Turni67 – 70Combined sources4
Beta strandi71 – 80Combined sources10
Helixi88 – 90Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2MNWNMR-A1-96[»]
4PBDX-ray1.68A1-96[»]
4PCKX-ray2.40A/B1-96[»]
ProteinModelPortaliQ6PI26.
SMRiQ6PI26.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 89CSPROSITE-ProRule annotationAdd BLAST89

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi441 – 490Ser-richAdd BLAST50

Sequence similaritiesi

Belongs to the SHQ1 family.Curated
Contains 1 CS domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3247. Eukaryota.
ENOG410ZIEU. LUCA.
GeneTreeiENSGT00390000007605.
HOGENOMiHOG000070000.
HOVERGENiHBG062935.
InParanoidiQ6PI26.
KOiK14764.
OMAiITDYCIW.
OrthoDBiEOG091G0CML.
PhylomeDBiQ6PI26.
TreeFamiTF106118.

Family and domain databases

InterProiIPR007052. CS_dom.
IPR008978. HSP20-like_chaperone.
IPR007009. SHQ1.
[Graphical view]
PfamiPF04925. SHQ1. 1 hit.
[Graphical view]
SUPFAMiSSF49764. SSF49764. 1 hit.
PROSITEiPS51203. CS. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6PI26-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLTPAFDLSQ DPDFLTIAIR VPYARVSEFD VYFEGSDFKF YAKPYFLRLT
60 70 80 90 100
LPGRIVENGS EQGSYDADKG IFTIRLPKET PGQHFEGLNM LTALLAPRKS
110 120 130 140 150
RTAKPLVEEI GASEIPEEVV DDEEFDWEIE QTPCEEVSES ALNPQCHYGF
160 170 180 190 200
GNLRSGVLQR LQDELSDVID IKDPDFTPAA ERRQKRLAAE LAKFDPDHYL
210 220 230 240 250
ADFFEDEAIE QILKYNPWWT DKYSKMMAFL EKSQEQENHA TLVSFSEEEK
260 270 280 290 300
YQLRKFVNKS YLLDKRACRQ VCYSLIDILL AYCYETRVTE GEKNVESAWN
310 320 330 340 350
IRKLSPTLCW FETWTNVHDI MVSFGRRVLC YPLYRHFKLV MKAYRDTIKI
360 370 380 390 400
LQLGKSAVLK CLLDIHKIFQ ENDPAYILND LYISDYCVWI QKVKSKKLAA
410 420 430 440 450
LAEALKEVSL TKAQLGLELE ELEAAALLVQ EEETALKAAH SVSGQQTLCS
460 470 480 490 500
SSEASDSEDS DSSVSSGNED SGSDSEQDEL KDSPSETVSS LQGPFLEESS
510 520 530 540 550
AFLIVDGGVR RNTAIQESDA SQGKPLASSW PLGVSGPLIE ELGEQLKTTV
560 570
QVSEPKGTTA VNRSNIQERD GCQTPNN
Length:577
Mass (Da):65,125
Last modified:September 11, 2007 - v2
Checksum:i277C2FC532A4D570
GO
Isoform 2 (identifier: Q6PI26-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: MLTPAFDLSQDPDFLTIAIRVPYARVSEFDVYFEGSDFKFYAKPYFLR → MNKTWSLSLKNGDCSCGGPI

Note: No experimental confirmation available.
Show »
Length:549
Mass (Da):61,548
Checksum:iB74B45664C41ACE1
GO

Sequence cautioni

The sequence BAA91669 differs from that shown. Reason: Frameshift at position 79.Curated
The sequence BAB14947 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti128E → Q in BAB14947 (PubMed:14702039).Curated1
Sequence conflicti505V → A in BAA91669 (PubMed:14702039).Curated1
Sequence conflicti506D → G in BAB14947 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_034962140S → I.1 PublicationCorresponds to variant rs17855677dbSNPEnsembl.1
Natural variantiVAR_034963489S → N.2 PublicationsCorresponds to variant rs35178407dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0561051 – 48MLTPA…PYFLR → MNKTWSLSLKNGDCSCGGPI in isoform 2. 1 PublicationAdd BLAST48

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK001401 mRNA. Translation: BAA91669.1. Frameshift.
AK024656 mRNA. Translation: BAB14947.1. Different initiation.
AK296789 mRNA. Translation: BAG59367.1.
AC114876 Genomic DNA. No translation available.
AC134050 Genomic DNA. No translation available.
BC017204 mRNA. Translation: AAH17204.1.
BC017274 mRNA. Translation: AAH17274.1.
BC025270 mRNA. Translation: AAH25270.1.
BC032671 mRNA. Translation: AAH32671.1.
BC039830 mRNA. Translation: AAH39830.1.
BC047879 mRNA. Translation: AAH47879.1.
BX641074 mRNA. Translation: CAE46037.1.
CCDSiCCDS33788.1. [Q6PI26-1]
RefSeqiNP_060600.2. NM_018130.2. [Q6PI26-1]
UniGeneiHs.606584.

Genome annotation databases

EnsembliENST00000325599; ENSP00000315182; ENSG00000144736. [Q6PI26-1]
ENST00000463369; ENSP00000417452; ENSG00000144736. [Q6PI26-2]
GeneIDi55164.
KEGGihsa:55164.
UCSCiuc003dpf.4. human. [Q6PI26-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK001401 mRNA. Translation: BAA91669.1. Frameshift.
AK024656 mRNA. Translation: BAB14947.1. Different initiation.
AK296789 mRNA. Translation: BAG59367.1.
AC114876 Genomic DNA. No translation available.
AC134050 Genomic DNA. No translation available.
BC017204 mRNA. Translation: AAH17204.1.
BC017274 mRNA. Translation: AAH17274.1.
BC025270 mRNA. Translation: AAH25270.1.
BC032671 mRNA. Translation: AAH32671.1.
BC039830 mRNA. Translation: AAH39830.1.
BC047879 mRNA. Translation: AAH47879.1.
BX641074 mRNA. Translation: CAE46037.1.
CCDSiCCDS33788.1. [Q6PI26-1]
RefSeqiNP_060600.2. NM_018130.2. [Q6PI26-1]
UniGeneiHs.606584.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2MNWNMR-A1-96[»]
4PBDX-ray1.68A1-96[»]
4PCKX-ray2.40A/B1-96[»]
ProteinModelPortaliQ6PI26.
SMRiQ6PI26.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120464. 14 interactors.
IntActiQ6PI26. 7 interactors.
STRINGi9606.ENSP00000315182.

PTM databases

iPTMnetiQ6PI26.
PhosphoSitePlusiQ6PI26.

Polymorphism and mutation databases

BioMutaiSHQ1.
DMDMi158563966.

Proteomic databases

EPDiQ6PI26.
MaxQBiQ6PI26.
PaxDbiQ6PI26.
PeptideAtlasiQ6PI26.
PRIDEiQ6PI26.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000325599; ENSP00000315182; ENSG00000144736. [Q6PI26-1]
ENST00000463369; ENSP00000417452; ENSG00000144736. [Q6PI26-2]
GeneIDi55164.
KEGGihsa:55164.
UCSCiuc003dpf.4. human. [Q6PI26-1]

Organism-specific databases

CTDi55164.
DisGeNETi55164.
GeneCardsiSHQ1.
H-InvDBHIX0003461.
HGNCiHGNC:25543. SHQ1.
HPAiHPA042792.
MIMi613663. gene.
neXtProtiNX_Q6PI26.
OpenTargetsiENSG00000144736.
PharmGKBiPA142670921.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3247. Eukaryota.
ENOG410ZIEU. LUCA.
GeneTreeiENSGT00390000007605.
HOGENOMiHOG000070000.
HOVERGENiHBG062935.
InParanoidiQ6PI26.
KOiK14764.
OMAiITDYCIW.
OrthoDBiEOG091G0CML.
PhylomeDBiQ6PI26.
TreeFamiTF106118.

Miscellaneous databases

GenomeRNAii55164.
PROiQ6PI26.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000144736.
CleanExiHS_SHQ1.
ExpressionAtlasiQ6PI26. baseline and differential.
GenevisibleiQ6PI26. HS.

Family and domain databases

InterProiIPR007052. CS_dom.
IPR008978. HSP20-like_chaperone.
IPR007009. SHQ1.
[Graphical view]
PfamiPF04925. SHQ1. 1 hit.
[Graphical view]
SUPFAMiSSF49764. SSF49764. 1 hit.
PROSITEiPS51203. CS. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSHQ1_HUMAN
AccessioniPrimary (citable) accession number: Q6PI26
Secondary accession number(s): B4DL05
, Q6MZJ4, Q7Z748, Q9H7E5, Q9NVS8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: September 11, 2007
Last modified: November 30, 2016
This is version 106 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.