Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kv channel-interacting protein 4

Gene

Kcnip4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels, such as KCND2/Kv4.2 and KCND3/Kv4.3 (PubMed:19109250). Modulates channel expression at the cell membrane, gating characteristics, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner.3 Publications

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Calcium bindingi133 – 144121PROSITE-ProRule annotationAdd
BLAST
Calcium bindingi169 – 180122PROSITE-ProRule annotation1 PublicationAdd
BLAST
Calcium bindingi217 – 228123PROSITE-ProRule annotation1 PublicationAdd
BLAST

GO - Molecular functioni

  • calcium ion binding Source: UniProtKB
  • potassium channel activity Source: UniProtKB-KW
  • potassium channel regulator activity Source: UniProtKB
  • voltage-gated ion channel activity Source: UniProtKB-KW

GO - Biological processi

  • protein localization to plasma membrane Source: UniProtKB
  • regulation of potassium ion transmembrane transport Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Ion channel, Potassium channel, Voltage-gated channel

Keywords - Biological processi

Ion transport, Potassium transport, Transport

Keywords - Ligandi

Calcium, Metal-binding, Potassium

Enzyme and pathway databases

ReactomeiR-MMU-5576894. Phase 1 - inactivation of fast Na+ channels.

Names & Taxonomyi

Protein namesi
Recommended name:
Kv channel-interacting protein 4
Short name:
KChIP4
Alternative name(s):
A-type potassium channel modulatory protein 4
Calsenilin-like protein
Potassium channel-interacting protein 4
Gene namesi
Name:Kcnip4
Synonyms:Calp, Kchip4
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 5

Organism-specific databases

MGIiMGI:1933131. Kcnip4.

Subcellular locationi

  • Cell membrane By similarity; Peripheral membrane protein Curated
  • Cytoplasm By similarity

GO - Cellular componenti

  • cytoplasm Source: MGI
  • cytosol Source: UniProtKB
  • plasma membrane Source: UniProtKB
  • voltage-gated potassium channel complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 250250Kv channel-interacting protein 4PRO_0000073827Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei17 – 171PhosphoserineCombined sources
Modified residuei56 – 561PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ6PHZ8.
PaxDbiQ6PHZ8.
PRIDEiQ6PHZ8.

PTM databases

iPTMnetiQ6PHZ8.
PhosphoSiteiQ6PHZ8.

Expressioni

Tissue specificityi

Expressed in brain. Highly expressed by neurons in layers II-IV of cortex and in hippocampus, thalamus and the Purkinje cell layer of the cerebellum.3 Publications

Gene expression databases

BgeeiENSMUSG00000029088.
CleanExiMM_KCNIP4.
ExpressionAtlasiQ6PHZ8. baseline and differential.
GenevisibleiQ6PHZ8. MM.

Interactioni

Subunit structurei

Component of heteromultimeric potassium channels (PubMed:19713751, PubMed:20943905). Identified in potassium channel complexes containing KCND1, KCND2, KCND3, KCNIP1, KCNIP2, KCNIP3, KCNIP4, DPP6 and DPP10 (PubMed:19713751). Interacts with the C-terminus of PSEN2 and probably PSEN1 (By similarity). Interacts with KCND2 and KCND3.By similarity4 Publications

Protein-protein interaction databases

IntActiQ6PHZ8. 1 interaction.
MINTiMINT-4128953.
STRINGi10090.ENSMUSP00000084656.

Structurei

Secondary structure

1
250
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi57 – 615Combined sources
Helixi69 – 9527Combined sources
Helixi105 – 11511Combined sources
Beta strandi118 – 1203Combined sources
Helixi121 – 13010Combined sources
Helixi142 – 15413Combined sources
Helixi157 – 16812Combined sources
Helixi178 – 19114Combined sources
Helixi208 – 2169Combined sources
Beta strandi221 – 2233Combined sources
Helixi226 – 2349Combined sources
Helixi237 – 24610Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3DD4X-ray3.00A56-250[»]
ProteinModelPortaliQ6PHZ8.
SMRiQ6PHZ8. Positions 53-250.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ6PHZ8.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini61 – 11757EF-hand 1; degeneratePROSITE-ProRule annotationAdd
BLAST
Domaini120 – 15536EF-hand 2PROSITE-ProRule annotationAdd
BLAST
Domaini156 – 19136EF-hand 3PROSITE-ProRule annotationAdd
BLAST
Domaini204 – 23936EF-hand 4PROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni2 – 4443KISAdd
BLAST
Regioni237 – 25014Interaction with KCND2By similarityAdd
BLAST

Domaini

The KIS (K-channel inactivation suppressor) domain is required for converting A-type Kv4 current to a slowly inactivating delayed rectifier potassium current.1 Publication

Sequence similaritiesi

Belongs to the recoverin family.Curated
Contains 4 EF-hand domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0044. Eukaryota.
COG5126. LUCA.
GeneTreeiENSGT00760000118820.
HOGENOMiHOG000233019.
HOVERGENiHBG108179.
InParanoidiQ6PHZ8.
OrthoDBiEOG091G11T4.
PhylomeDBiQ6PHZ8.
TreeFamiTF318560.

Family and domain databases

Gene3Di1.10.238.10. 3 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR028846. Recoverin.
[Graphical view]
PANTHERiPTHR23055. PTHR23055. 1 hit.
PfamiPF13499. EF-hand_7. 1 hit.
PF13833. EF-hand_8. 1 hit.
[Graphical view]
SMARTiSM00054. EFh. 3 hits.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
PROSITEiPS00018. EF_HAND_1. 3 hits.
PS50222. EF_HAND_2. 3 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6PHZ8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNVRRVESIS AQLEEASSTG GFLYAQNNTK RSIKERLMKL LPCSAAKTSS
60 70 80 90 100
PAIQNSVEDE LEMATVRHRP EALELLEAQS KFTKKELQIL YRGFKNECPS
110 120 130 140 150
GVVNEETFKE IYSQFFPQGD STTYAHFLFN AFDTDHNGAV SFEDFIKGLS
160 170 180 190 200
ILLRGTVQEK LNWAFNLYDI NKDGYITKEE MLDIMKAIYD MMGKCTYPVL
210 220 230 240 250
KEDAPRQHVE TFFQKMDKNK DGVVTIDEFI ESCQKDENIM RSMQLFENVI
Length:250
Mass (Da):28,756
Last modified:July 19, 2004 - v1
Checksum:i56542298021192BF
GO
Isoform 2 (identifier: Q6PHZ8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     21-55: GFLYAQNNTKRSIKERLMKLLPCSAAKTSSPAIQN → D

Note: Derived from EST data. No experimental confirmation available.
Show »
Length:216
Mass (Da):25,008
Checksum:i17C4AFD3B4CFF23C
GO
Isoform 3 (identifier: Q6PHZ8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-62: Missing.

Show »
Length:188
Mass (Da):21,945
Checksum:i9F46CA3A8A308410
GO
Isoform 4 (identifier: Q6PHZ8-4) [UniParc]FASTAAdd to basket
Also known as: KChIPa

The sequence of this isoform differs from the canonical sequence as follows:
     1-55: MNVRRVESIS...AKTSSPAIQN → MNLEGLEMIAVLIVIVLFVKLLEQFGLIEAGLED

Show »
Length:229
Mass (Da):26,502
Checksum:i08DF864F1A838BE8
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti32 – 321S → T in AAG36976 (PubMed:11847232).Curated
Sequence conflicti67 – 671R → K in BAC30218 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6262Missing in isoform 3. 1 PublicationVSP_015069Add
BLAST
Alternative sequencei1 – 5555MNVRR…PAIQN → MNLEGLEMIAVLIVIVLFVK LLEQFGLIEAGLED in isoform 4. 2 PublicationsVSP_015070Add
BLAST
Alternative sequencei21 – 5535GFLYA…PAIQN → D in isoform 2. 1 PublicationVSP_015071Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF305071 mRNA. Translation: AAG36976.1.
AF453243 mRNA. Translation: AAL86766.1.
AY647240 mRNA. Translation: AAT68466.1.
AK039048 mRNA. Translation: BAC30218.1.
BC051130 mRNA. Translation: AAH51130.1.
CK618709 mRNA. No translation available.
CCDSiCCDS39084.1. [Q6PHZ8-4]
CCDS57341.1. [Q6PHZ8-2]
CCDS57342.1. [Q6PHZ8-1]
RefSeqiNP_001186171.1. NM_001199242.1. [Q6PHZ8-1]
NP_001186172.1. NM_001199243.1. [Q6PHZ8-2]
NP_084541.3. NM_030265.3. [Q6PHZ8-4]
UniGeneiMm.160172.

Genome annotation databases

EnsembliENSMUST00000087395; ENSMUSP00000084656; ENSMUSG00000029088. [Q6PHZ8-1]
ENSMUST00000176191; ENSMUSP00000135071; ENSMUSG00000029088. [Q6PHZ8-2]
ENSMUST00000176978; ENSMUSP00000134758; ENSMUSG00000029088. [Q6PHZ8-4]
GeneIDi80334.
KEGGimmu:80334.
UCSCiuc033ijo.1. mouse. [Q6PHZ8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF305071 mRNA. Translation: AAG36976.1.
AF453243 mRNA. Translation: AAL86766.1.
AY647240 mRNA. Translation: AAT68466.1.
AK039048 mRNA. Translation: BAC30218.1.
BC051130 mRNA. Translation: AAH51130.1.
CK618709 mRNA. No translation available.
CCDSiCCDS39084.1. [Q6PHZ8-4]
CCDS57341.1. [Q6PHZ8-2]
CCDS57342.1. [Q6PHZ8-1]
RefSeqiNP_001186171.1. NM_001199242.1. [Q6PHZ8-1]
NP_001186172.1. NM_001199243.1. [Q6PHZ8-2]
NP_084541.3. NM_030265.3. [Q6PHZ8-4]
UniGeneiMm.160172.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3DD4X-ray3.00A56-250[»]
ProteinModelPortaliQ6PHZ8.
SMRiQ6PHZ8. Positions 53-250.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ6PHZ8. 1 interaction.
MINTiMINT-4128953.
STRINGi10090.ENSMUSP00000084656.

PTM databases

iPTMnetiQ6PHZ8.
PhosphoSiteiQ6PHZ8.

Proteomic databases

MaxQBiQ6PHZ8.
PaxDbiQ6PHZ8.
PRIDEiQ6PHZ8.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000087395; ENSMUSP00000084656; ENSMUSG00000029088. [Q6PHZ8-1]
ENSMUST00000176191; ENSMUSP00000135071; ENSMUSG00000029088. [Q6PHZ8-2]
ENSMUST00000176978; ENSMUSP00000134758; ENSMUSG00000029088. [Q6PHZ8-4]
GeneIDi80334.
KEGGimmu:80334.
UCSCiuc033ijo.1. mouse. [Q6PHZ8-1]

Organism-specific databases

CTDi80333.
MGIiMGI:1933131. Kcnip4.

Phylogenomic databases

eggNOGiKOG0044. Eukaryota.
COG5126. LUCA.
GeneTreeiENSGT00760000118820.
HOGENOMiHOG000233019.
HOVERGENiHBG108179.
InParanoidiQ6PHZ8.
OrthoDBiEOG091G11T4.
PhylomeDBiQ6PHZ8.
TreeFamiTF318560.

Enzyme and pathway databases

ReactomeiR-MMU-5576894. Phase 1 - inactivation of fast Na+ channels.

Miscellaneous databases

ChiTaRSiKcnip4. mouse.
EvolutionaryTraceiQ6PHZ8.
PROiQ6PHZ8.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000029088.
CleanExiMM_KCNIP4.
ExpressionAtlasiQ6PHZ8. baseline and differential.
GenevisibleiQ6PHZ8. MM.

Family and domain databases

Gene3Di1.10.238.10. 3 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR028846. Recoverin.
[Graphical view]
PANTHERiPTHR23055. PTHR23055. 1 hit.
PfamiPF13499. EF-hand_7. 1 hit.
PF13833. EF-hand_8. 1 hit.
[Graphical view]
SMARTiSM00054. EFh. 3 hits.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
PROSITEiPS00018. EF_HAND_1. 3 hits.
PS50222. EF_HAND_2. 3 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiKCIP4_MOUSE
AccessioniPrimary (citable) accession number: Q6PHZ8
Secondary accession number(s): Q6DTJ3
, Q8CAD0, Q8R4I2, Q9EQ01
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 16, 2005
Last sequence update: July 19, 2004
Last modified: September 7, 2016
This is version 105 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.