Q6PHU5 (SORT_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 75.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Sortilin Alternative name(s): Neurotensin receptor 3 Short name=NTR3 Short name=mNTR3 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus |
Protein attributes
| Sequence length | 825 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Functions as a sorting receptor in the Golgi compartment and as a clearance receptor on the cell surface. Required for protein transport from the Golgi apparatus to the lysosomes by a pathway that is independent of the mannose-6-phosphate receptor (M6PR). Also required for protein transport from the Golgi apparatus to the endosomes. Promotes neuronal apoptosis by mediating endocytosis of the proapoptotic precursor forms of BDNF (proBDNF) and NGFB (proNGFB). Also acts as a receptor for neurotensin. May promote mineralization of the extracellular matrix during osteogenic differentiation by scavenging extracellular LPL. Probably required in adipocytes for the formation of specialized storage vesicles containing the glucose transporter SLC2A4/GLUT4 (GLUT4 storage vesicles, or GSVs). These vesicles provide a stable pool of SLC2A4 and confer increased responsiveness to insulin. May also mediate transport from the endoplasmic reticulum to the Golgi. Ref.8 Ref.9 Ref.10 Ref.11 Ref.12 Ref.15 |
| Subunit structure | Interacts with the cytosolic adapter proteins GGA1 and GGA2. Interacts with numerous ligands including the receptor-associated protein LRPAP1/RAP, NTS and GM2A. Forms a complex with NGFR which binds specifically to the precursor forms of NGFB (proNGFB) and BDNF (proBDNF). Interacts with the Trk receptors NTRK1, NTRK2 and NTRK3; may regulate their anterograde axonal transport and signaling By similarity. Interacts with LPL, PSAP and SLC2A4. Interacts with NRADD and NGFR. Interaction with NRADD protects against degradation in the lysosome. Ref.7 Ref.9 Ref.12 |
| Subcellular location | Membrane; Single-pass type I membrane protein Potential. Endoplasmic reticulum membrane; Single-pass type I membrane protein Potential. Endosome membrane; Single-pass type I membrane protein Potential. Golgi apparatus › Golgi stack membrane; Single-pass type I membrane protein Potential. Lysosome membrane; Single-pass type I membrane protein Potential. Nucleus membrane; Single-pass type I membrane protein Potential. Cell membrane; Single-pass type I membrane protein; Extracellular side. Lysosome membrane; Single-pass type I membrane protein Potential. Note: Localized to membranes of the endoplasmic reticulum, endosomes, Golgi stack, lysosomes and nucleus. A small fraction of the protein is also localized to the plasma membrane. Interaction with NRADD promotes localization at the cell membrane in neurons; this promotes interaction with NGFR. Also found in SLC2A4/GLUT4 storage vesicles (GSVs) in adipocytes. Localization to the plasma membrane in adipocytes is enhanced by insulin. Ref.1 Ref.5 Ref.9 Ref.12 |
| Tissue specificity | Expressed in the brain, particularly the piriform cortex, the cerebral cortex and the hippocampus. Ref.6 |
| Developmental stage | Expressed in the ectoderm at E7.5 and within the germ cell layers at E8.5. Expressed within the neural epithelium and the neural tube at E9.5 and subsequently expressed in the nervous system throughout development. Expression in the proliferative zones of the central nervous system declines between E14.5 and E16.5, while expression remains high in the cerebral cortex and the neural retina. Expressed in the pituitary and the sensory epithelia throughout development. Ref.6 |
| Induction | |
| Domain | The N-terminal propeptide may facilitate precursor transport within the Golgi stack. Intrachain binding of the N-terminal propeptide and the extracellular domain may also inhibit premature ligand binding By similarity. The extracellular domain may be shed following protease cleavage in some cell types By similarity. |
| Post-translational modification | The N-terminal propeptide is cleaved by furin and possibly other homologous proteases By similarity. |
| Sequence similarities | Belongs to the VPS10-related sortilin family. SORT1 subfamily. Contains 9 BNR repeats. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6PHU5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6PHU5-2) The sequence of this isoform differs from the canonical sequence as follows: 748-748: Q → QDSRPQGHSLSQNPAPPPLGYTENTHFLSPTQKQ | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 31 | 31 | Potential | ||||||||
| Propeptide | 32 – 75 | 44 | Removed in mature form By similarity | PRO_0000045155 | |||||||
| Chain | 76 – 825 | 750 | Sortilin | PRO_0000045156 | |||||||
Regions | |||||||||||
| Topological domain | 32 – 754 | 723 | Extracellular Potential | ||||||||
| Transmembrane | 755 – 775 | 21 | Helical; Potential | ||||||||
| Topological domain | 776 – 825 | 50 | Cytoplasmic Potential | ||||||||
| Repeat | 143 – 154 | 12 | BNR 1 | ||||||||
| Repeat | 196 – 207 | 12 | BNR 2 | ||||||||
| Repeat | 238 – 249 | 12 | BNR 3 | ||||||||
| Repeat | 285 – 296 | 12 | BNR 4 | ||||||||
| Repeat | 326 – 337 | 12 | BNR 5 | ||||||||
| Repeat | 375 – 386 | 12 | BNR 6 | ||||||||
| Repeat | 426 – 437 | 12 | BNR 7 | ||||||||
| Repeat | 504 – 515 | 12 | BNR 8 | ||||||||
| Repeat | 546 – 557 | 12 | BNR 9 | ||||||||
| Region | 48 – 59 | 12 | Intrachain binding of the propeptide and the extracellular domain By similarity | ||||||||
| Region | 610 – 754 | 145 | Interactions with LRPAP1 and NGFB By similarity | ||||||||
| Region | 777 – 825 | 49 | Golgi to endosome transport and interactions with GGA1 and GGA2 By similarity | ||||||||
| Motif | 785 – 790 | 6 | Endocytosis signal Potential | ||||||||
| Compositional bias | 38 – 44 | 7 | Poly-Pro | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 819 | 1 | Phosphoserine Ref.13 | ||||||||
| Glycosylation | 96 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 160 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 272 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 404 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 580 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 682 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 84 ↔ 554 | By similarity | |||||||||
| Disulfide bond | 255 ↔ 275 | By similarity | |||||||||
| Disulfide bond | 446 ↔ 456 | By similarity | |||||||||
| Disulfide bond | 610 ↔ 649 | By similarity | |||||||||
| Disulfide bond | 632 ↔ 664 | By similarity | |||||||||
| Disulfide bond | 666 ↔ 721 | By similarity | |||||||||
| Disulfide bond | 673 ↔ 686 | By similarity | |||||||||
| Disulfide bond | 700 ↔ 738 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 748 | 1 | Q → QDSRPQGHSLSQNPAPPPLG YTENTHFLSPTQKQ in isoform 2. | VSP_016650 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 315 | 1 | V → E in AAF22639. Ref.1 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Pharmacological properties of the mouse neurotensin receptor 3. Maintenance of cell surface receptor during internalization of neurotensin." Navarro V., Martin S., Sarret P., Nielsen M.S., Petersen C.M., Vincent J.-P., Mazella J. FEBS Lett. 495:100-105(2001) [PubMed: 11322955] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), IDENTIFICATION AS A NEUROTENSIN RECEPTOR, SUBCELLULAR LOCATION, GLYCOSYLATION. Strain: BALB/c. Tissue: Brain. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: C57BL/6. Tissue: Brain. |
| [3] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed: 19468303] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: C57BL/6. Tissue: Brain and Salivary gland. |
| [5] | "Sortilin is the major 110-kDa protein in GLUT4 vesicles from adipocytes." Morris N.J., Ross S.A., Lane W.S., Moestrup S.K., Petersen C.M., Keller S.R., Lienhard G.E. J. Biol. Chem. 273:3582-3587(1998) [PubMed: 9452485] [Abstract] Cited for: SUBCELLULAR LOCATION, INDUCTION. |
| [6] | "Expression of the 100-kDa neurotensin receptor sortilin during mouse embryonal development." Hermans-Borgmeyer I., Hermey G., Nykjaer A., Schaller C. Brain Res. Mol. Brain Res. 65:216-219(1999) [PubMed: 10064893] [Abstract] Cited for: TISSUE SPECIFICITY, DEVELOPMENTAL STAGE. |
| [7] | "Sortilin/neurotensin receptor-3 binds and mediates degradation of lipoprotein lipase." Nielsen M.S., Jacobsen C., Olivecrona G., Gliemann J., Petersen C.M. J. Biol. Chem. 274:8832-8836(1999) [PubMed: 10085125] [Abstract] Cited for: INTERACTION WITH LPL. |
| [8] | "Characterization of insulin-responsive GLUT4 storage vesicles isolated from 3T3-L1 adipocytes." Hashiramoto M., James D.E. Mol. Cell. Biol. 20:416-427(2000) [PubMed: 10594043] [Abstract] Cited for: FUNCTION. |
| [9] | "Study of the mouse sortilin gene: effects of its transient silencing by RNA interference in TM4 Sertoli cells." Zeng J., Hassan A.J., Morales C.R. Mol. Reprod. Dev. 68:469-475(2004) [PubMed: 15236332] [Abstract] Cited for: FUNCTION, INTERACTION WITH PSAP, SUBCELLULAR LOCATION. |
| [10] | "The trafficking of prosaposin (SGP-1) and GM2AP to the lysosomes of TM4 Sertoli cells is mediated by sortilin and monomeric adaptor proteins." Hassan A.J., Zeng J., Ni X., Morales C.R. Mol. Reprod. Dev. 68:476-483(2004) [PubMed: 15236333] [Abstract] Cited for: FUNCTION. |
| [11] | "Neurotensin receptor-3/sortilin mediates neurotensin-induced cytokine/chemokine expression in a murine microglial cell line." Dicou E., Vincent J.-P., Mazella J. J. Neurosci. Res. 78:92-99(2004) [PubMed: 15372498] [Abstract] Cited for: FUNCTION. |
| [12] | "Sortilin is essential and sufficient for the formation of Glut4 storage vesicles in 3T3-L1 adipocytes." Shi J., Kandror K.V. Dev. Cell 9:99-108(2005) [PubMed: 15992544] [Abstract] Cited for: FUNCTION, INTERACTION WITH SLC2A4, SUBCELLULAR LOCATION, INDUCTION. |
| [13] | "Protein phosphorylation and expression profiling by Yin-yang multidimensional liquid chromatography (Yin-yang MDLC) mass spectrometry." Dai J., Jin W.-H., Sheng Q.-H., Shieh C.-H., Wu J.-R., Zeng R. J. Proteome Res. 6:250-262(2007) [PubMed: 17203969] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-819, MASS SPECTROMETRY. Tissue: Liver. |
| [14] | "NRH2 is a trafficking switch to regulate sortilin localization and permit proneurotrophin-induced cell death." Kim T., Hempstead B.L. EMBO J. 28:1612-1623(2009) [PubMed: 19407813] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH NGFR AND NRADD. |
| [15] | "Sortilin associates with Trk receptors to enhance anterograde transport and neurotrophin signaling." Vaegter C.B., Jansen P., Fjorback A.W., Glerup S., Skeldal S., Kjolby M., Richner M., Erdmann B., Nyengaard J.R., Tessarollo L., Lewin G.R., Willnow T.E., Chao M.V., Nykjaer A. Nat. Neurosci. 14:54-61(2011) [PubMed: 21102451] [Abstract] Cited for: FUNCTION IN NTRK1 SIGNALING. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF175279 mRNA. Translation: AAF22639.1. AK147442 mRNA. Translation: BAE27915.1. AL671899 Genomic DNA. Translation: CAM19473.1. BC034129 mRNA. Translation: AAH34129.1. BC056343 mRNA. Translation: AAH56343.1. |
| IPI | IPI00420955. IPI00650038. |
| RefSeq | NP_064356.2. NM_019972.2. |
| UniGene | Mm.157119. |
3D structure databases | |
| ProteinModelPortal | Q6PHU5. |
| SMR | Q6PHU5. Positions 86-747. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-46095N. |
| STRING | Q6PHU5. |
PTM databases | |
| PhosphoSite | Q6PHU5. |
Proteomic databases | |
| PRIDE | Q6PHU5. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000090564; ENSMUSP00000088052; ENSMUSG00000068747. ENSMUST00000102632; ENSMUSP00000099692; ENSMUSG00000068747. |
| GeneID | 20661. |
| KEGG | mmu:20661. |
| UCSC | uc008qyr.1. mouse. uc008qys.1. mouse. |
Organism-specific databases | |
| CTD | 6272. |
| MGI | MGI:1338015. Sort1. |
Phylogenomic databases | |
| GeneTree | ENSGT00510000046443. |
| HOVERGEN | HBG080235. |
| OMA | LTQMMYS. |
| OrthoDB | EOG4QVCBD. |
| PhylomeDB | Q6PHU5. |
Gene expression databases | |
| ArrayExpress | Q6PHU5. |
| Bgee | Q6PHU5. |
| CleanEx | MM_SORT1. |
| Genevestigator | Q6PHU5. |
| GermOnline | ENSMUSG00000068747. Mus musculus. |
Family and domain databases | |
| InterPro | IPR002860. BNR_rpt. IPR006581. VPS10. [Graphical view] |
| KO | K12388. |
| Pfam | PF02012. BNR. 5 hits. [Graphical view] |
| SMART | SM00602. VPS10. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 299105. |
| SOURCE | Search... |
Entry information
| Entry name | SORT_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q6PHU5 Secondary accession number(s): A2AEE8 Q9QXW6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with