Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine/threonine-protein kinase ULK3

Gene

ULK3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Serine/threonine protein kinase that acts as a regulator of Sonic hedgehog (SHH) signaling and autophagy. Acts as a negative regulator of SHH signaling in the absence of SHH ligand: interacts with SUFU, thereby inactivating the protein kinase activity and preventing phosphorylation of GLI proteins (GLI1, GLI2 and/or GLI3). Positively regulates SHH signaling in the presence of SHH: dissociates from SUFU, autophosphorylates and mediates phosphorylation of GLI2, activating it and promoting its nuclear translocation. Phosphorylates in vitro GLI2, as well as GLI1 and GLI3, although less efficiently. Also acts as a regulator of autophagy: following cellular senescence, able to induce autophagy.3 Publications

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei44 – 441ATPPROSITE-ProRule annotation
Active sitei137 – 1371Proton acceptorPROSITE-ProRule annotation

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi20 – 289ATPPROSITE-ProRule annotation

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • protein serine/threonine kinase activity Source: UniProtKB

GO - Biological processi

  • autophagy Source: UniProtKB
  • cellular senescence Source: UniProtKB
  • negative regulation of smoothened signaling pathway Source: UniProtKB
  • positive regulation of smoothened signaling pathway Source: UniProtKB
  • protein autophosphorylation Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Biological processi

Autophagy

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi2.7.11.1. 2681.
ReactomeiR-HSA-5632684. Hedgehog 'on' state.
SignaLinkiQ6PHR2.

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/threonine-protein kinase ULK3 (EC:2.7.11.1)
Alternative name(s):
Unc-51-like kinase 3
Gene namesi
Name:ULK3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

HGNCiHGNC:19703. ULK3.

Subcellular locationi

GO - Cellular componenti

  • ciliary tip Source: Reactome
  • cytoplasm Source: UniProtKB
  • pre-autophagosomal structure Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi44 – 441K → R: Decreased kinase activity. 1 Publication
Mutagenesisi139 – 1391K → R: Loss of kinase activity. Does not promote GLI1 nuclear localization. 2 Publications

Organism-specific databases

PharmGKBiPA134908392.

Chemistry

ChEMBLiCHEMBL5047.
GuidetoPHARMACOLOGYi2273.

Polymorphism and mutation databases

DMDMi259016166.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 472472Serine/threonine-protein kinase ULK3PRO_0000250150Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei176 – 1761PhosphoserineCombined sources
Modified residuei300 – 3001Phosphoserine; by autocatalysis1 Publication
Modified residuei350 – 3501Phosphoserine; by autocatalysis1 Publication
Modified residuei384 – 3841Phosphoserine; by autocatalysis1 Publication
Modified residuei464 – 4641Phosphoserine; by autocatalysis1 Publication

Post-translational modificationi

Autophosphorylated. Autophosphorylation is blocked by interaction with SUFU.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ6PHR2.
MaxQBiQ6PHR2.
PaxDbiQ6PHR2.
PeptideAtlasiQ6PHR2.
PRIDEiQ6PHR2.

PTM databases

iPTMnetiQ6PHR2.
PhosphoSiteiQ6PHR2.

Expressioni

Tissue specificityi

Widely expressed. Highest levels observed in fetal brain. In adult tissues, high levels in brain, liver and kidney, moderate levels in testis and adrenal gland and low levels in heart, lung, stomach, thymus, prostate and placenta. In the brain, highest expression in the hippocampus, high levels also detected in the cerebellum, olfactory bulb and optic nerve. In the central nervous system, lowest levels in the spinal cord.1 Publication

Inductioni

Up-regulated during senescence.1 Publication

Gene expression databases

BgeeiQ6PHR2.
CleanExiHS_ULK3.
ExpressionAtlasiQ6PHR2. baseline and differential.
GenevisibleiQ6PHR2. HS.

Organism-specific databases

HPAiHPA040474.

Interactioni

Subunit structurei

Interacts (via protein kinase domain) with SUFU.1 Publication

Protein-protein interaction databases

BioGridi117470. 7 interactions.
IntActiQ6PHR2. 1 interaction.
STRINGi9606.ENSP00000400312.

Chemistry

BindingDBiQ6PHR2.

Structurei

Secondary structure

1
472
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi362 – 3698Combined sources
Turni370 – 3723Combined sources
Helixi374 – 39017Combined sources
Helixi396 – 41621Combined sources
Helixi421 – 44525Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4WZXX-ray1.39A359-449[»]
ProteinModelPortaliQ6PHR2.
SMRiQ6PHR2. Positions 7-345, 360-446.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini14 – 270257Protein kinasePROSITE-ProRule annotationAdd
BLAST
Domaini280 – 34869MIT 1Add
BLAST
Domaini375 – 44470MIT 2Add
BLAST

Sequence similaritiesi

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. APG1/unc-51/ULK1 subfamily.PROSITE-ProRule annotation
Contains 2 MIT domains.Curated
Contains 1 protein kinase domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0595. Eukaryota.
ENOG410XR01. LUCA.
GeneTreeiENSGT00820000126991.
HOGENOMiHOG000233016.
HOVERGENiHBG094133.
InParanoidiQ6PHR2.
KOiK08269.
OMAiALHYEAD.
OrthoDBiEOG71G9VJ.
PhylomeDBiQ6PHR2.
TreeFamiTF324551.

Family and domain databases

Gene3Di1.20.58.280. 2 hits.
InterProiIPR011009. Kinase-like_dom.
IPR007330. MIT.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF04212. MIT. 2 hits.
PF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00745. MIT. 2 hits.
SM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF116846. SSF116846. 2 hits.
SSF56112. SSF56112. 1 hit.
PROSITEiPS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6PHR2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGPGWGPPR LDGFILTERL GSGTYATVYK AYAKKDTREV VAIKCVAKKS
60 70 80 90 100
LNKASVENLL TEIEILKGIR HPHIVQLKDF QWDSDNIYLI MEFCAGGDLS
110 120 130 140 150
RFIHTRRILP EKVARVFMQQ LASALQFLHE RNISHLDLKP QNILLSSLEK
160 170 180 190 200
PHLKLADFGF AQHMSPWDEK HVLRGSPLYM APEMVCQRQY DARVDLWSMG
210 220 230 240 250
VILYEALFGQ PPFASRSFSE LEEKIRSNRV IELPLRPLLS RDCRDLLQRL
260 270 280 290 300
LERDPSRRIS FQDFFAHPWV DLEHMPSGES LGRATALVVQ AVKKDQEGDS
310 320 330 340 350
AAALSLYCKA LDFFVPALHY EVDAQRKEAI KAKVGQYVSR AEELKAIVSS
360 370 380 390 400
SNQALLRQGT SARDLLREMA RDKPRLLAAL EVASAAMAKE EAAGGEQDAL
410 420 430 440 450
DLYQHSLGEL LLLLAAEPPG RRRELLHTEV QNLMARAEYL KEQVKMRESR
460 470
WEADTLDKEG LSESVRSSCT LQ
Length:472
Mass (Da):53,444
Last modified:September 22, 2009 - v2
Checksum:i11D03E311AF36162
GO
Isoform 2 (identifier: Q6PHR2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     205-214: EALFGQPPFA → GETSFPCFSP
     215-472: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:214
Mass (Da):24,402
Checksum:iB51B24CC2A2A0D0E
GO
Isoform 3 (identifier: Q6PHR2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     444-445: Missing.

Note: May be due to competing donor splice site. No experimental confirmation available.
Show »
Length:470
Mass (Da):53,217
Checksum:iB00A71FDAD785B64
GO
Isoform 4 (identifier: Q6PHR2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MAGPGWGPPRLDGFILTERLGSGTYATVYKAYAK → MQRNGSASRG...ESWEARCWCA

Note: No experimental confirmation available.
Show »
Length:483
Mass (Da):54,997
Checksum:i6987C57ACDD4B6CC
GO

Sequence cautioni

The sequence CAB55955.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti47 – 471A → S in BAG61369 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti101 – 1011R → H.
Corresponds to variant rs34945944 [ dbSNP | Ensembl ].
VAR_057113
Natural varianti445 – 4451K → R.
Corresponds to variant rs12898397 [ dbSNP | Ensembl ].
VAR_059771

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3434MAGPG…KAYAK → MQRNGSASRGLEKTRLRLCR EARIPESAFLTGLTRESWEA RCWCA in isoform 4. 1 PublicationVSP_057411Add
BLAST
Alternative sequencei205 – 21410EALFGQPPFA → GETSFPCFSP in isoform 2. 3 PublicationsVSP_038147
Alternative sequencei215 – 472258Missing in isoform 2. 3 PublicationsVSP_038148Add
BLAST
Alternative sequencei444 – 4452Missing in isoform 3. 1 PublicationVSP_039925

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK294245 mRNA. Translation: BAG57541.1.
AK299380 mRNA. Translation: BAG61369.1.
AL117482 mRNA. Translation: CAB55955.2. Different initiation.
AC091230 Genomic DNA. No translation available.
BC036117 mRNA. No translation available.
BC056423 mRNA. No translation available.
CH471136 Genomic DNA. Translation: EAW99301.1.
CH471136 Genomic DNA. Translation: EAW99303.1.
BC157884 mRNA. Translation: AAI57885.1.
AL360256 mRNA. Translation: CAB96176.1.
CCDSiCCDS45305.1. [Q6PHR2-1]
CCDS76779.1. [Q6PHR2-3]
PIRiT17265.
RefSeqiNP_001092906.3. NM_001099436.3. [Q6PHR2-1]
NP_001271293.2. NM_001284364.2. [Q6PHR2-3]
NP_001271294.1. NM_001284365.2.
XP_005254346.1. XM_005254289.2. [Q6PHR2-4]
UniGeneiHs.513034.

Genome annotation databases

EnsembliENST00000440863; ENSP00000400312; ENSG00000140474. [Q6PHR2-1]
ENST00000568667; ENSP00000457853; ENSG00000140474. [Q6PHR2-4]
ENST00000569437; ENSP00000456051; ENSG00000140474. [Q6PHR2-3]
GeneIDi25989.
KEGGihsa:25989.
UCSCiuc010ulq.3. human.
uc059llp.1. human. [Q6PHR2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK294245 mRNA. Translation: BAG57541.1.
AK299380 mRNA. Translation: BAG61369.1.
AL117482 mRNA. Translation: CAB55955.2. Different initiation.
AC091230 Genomic DNA. No translation available.
BC036117 mRNA. No translation available.
BC056423 mRNA. No translation available.
CH471136 Genomic DNA. Translation: EAW99301.1.
CH471136 Genomic DNA. Translation: EAW99303.1.
BC157884 mRNA. Translation: AAI57885.1.
AL360256 mRNA. Translation: CAB96176.1.
CCDSiCCDS45305.1. [Q6PHR2-1]
CCDS76779.1. [Q6PHR2-3]
PIRiT17265.
RefSeqiNP_001092906.3. NM_001099436.3. [Q6PHR2-1]
NP_001271293.2. NM_001284364.2. [Q6PHR2-3]
NP_001271294.1. NM_001284365.2.
XP_005254346.1. XM_005254289.2. [Q6PHR2-4]
UniGeneiHs.513034.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4WZXX-ray1.39A359-449[»]
ProteinModelPortaliQ6PHR2.
SMRiQ6PHR2. Positions 7-345, 360-446.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117470. 7 interactions.
IntActiQ6PHR2. 1 interaction.
STRINGi9606.ENSP00000400312.

Chemistry

BindingDBiQ6PHR2.
ChEMBLiCHEMBL5047.
GuidetoPHARMACOLOGYi2273.

PTM databases

iPTMnetiQ6PHR2.
PhosphoSiteiQ6PHR2.

Polymorphism and mutation databases

DMDMi259016166.

Proteomic databases

EPDiQ6PHR2.
MaxQBiQ6PHR2.
PaxDbiQ6PHR2.
PeptideAtlasiQ6PHR2.
PRIDEiQ6PHR2.

Protocols and materials databases

DNASUi25989.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000440863; ENSP00000400312; ENSG00000140474. [Q6PHR2-1]
ENST00000568667; ENSP00000457853; ENSG00000140474. [Q6PHR2-4]
ENST00000569437; ENSP00000456051; ENSG00000140474. [Q6PHR2-3]
GeneIDi25989.
KEGGihsa:25989.
UCSCiuc010ulq.3. human.
uc059llp.1. human. [Q6PHR2-1]

Organism-specific databases

CTDi25989.
GeneCardsiULK3.
H-InvDBHIX0012431.
HGNCiHGNC:19703. ULK3.
HPAiHPA040474.
MIMi613472. gene.
neXtProtiNX_Q6PHR2.
PharmGKBiPA134908392.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0595. Eukaryota.
ENOG410XR01. LUCA.
GeneTreeiENSGT00820000126991.
HOGENOMiHOG000233016.
HOVERGENiHBG094133.
InParanoidiQ6PHR2.
KOiK08269.
OMAiALHYEAD.
OrthoDBiEOG71G9VJ.
PhylomeDBiQ6PHR2.
TreeFamiTF324551.

Enzyme and pathway databases

BRENDAi2.7.11.1. 2681.
ReactomeiR-HSA-5632684. Hedgehog 'on' state.
SignaLinkiQ6PHR2.

Miscellaneous databases

GenomeRNAii25989.
PROiQ6PHR2.
SOURCEiSearch...

Gene expression databases

BgeeiQ6PHR2.
CleanExiHS_ULK3.
ExpressionAtlasiQ6PHR2. baseline and differential.
GenevisibleiQ6PHR2. HS.

Family and domain databases

Gene3Di1.20.58.280. 2 hits.
InterProiIPR011009. Kinase-like_dom.
IPR007330. MIT.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF04212. MIT. 2 hits.
PF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00745. MIT. 2 hits.
SM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF116846. SSF116846. 2 hits.
SSF56112. SSF56112. 1 hit.
PROSITEiPS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4).
    Tissue: Amygdala and Tongue.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.
  3. "Analysis of the DNA sequence and duplication history of human chromosome 15."
    Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
    , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
    Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Tissue: Blood and Brain.
  6. The European IMAGE consortium
    Submitted (JUL-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 162-472 (ISOFORM 2).
  7. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-176, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. Cited for: FUNCTION, SUBCELLULAR LOCATION, INDUCTION.
  9. "Identification of a novel serine/threonine kinase ULK3 as a positive regulator of Hedgehog pathway."
    Maloverjan A., Piirsoo M., Michelson P., Kogerman P., Osterlund T.
    Exp. Cell Res. 316:627-637(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, AUTOPHOSPHORYLATION, MUTAGENESIS OF LYS-44 AND LYS-139.
  10. "Dual function of UNC-51-like kinase 3 (Ulk3) in the Sonic hedgehog signaling pathway."
    Maloverjan A., Piirsoo M., Kasak L., Peil L., Osterlund T., Kogerman P.
    J. Biol. Chem. 285:30079-30090(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, AUTOPHOSPHORYLATION, INTERACTION WITH SUFU, MUTAGENESIS OF LYS-139, PHOSPHORYLATION AT SER-300; SER-350; SER-384 AND SER-464.
  11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiULK3_HUMAN
AccessioniPrimary (citable) accession number: Q6PHR2
Secondary accession number(s): B2RXK3
, B4DFT0, B4DRQ7, D3DW68, Q9NPN5, Q9UFS4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 19, 2006
Last sequence update: September 22, 2009
Last modified: July 6, 2016
This is version 125 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.