Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

ERC protein 2

Gene

Erc2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Thought to be involved in the organization of the cytomatrix at the nerve terminals active zone (CAZ) which regulates neurotransmitter release. Seems to act together with BSN. May recruit liprin-alpha proteins to the CAZ.

Names & Taxonomyi

Protein namesi
Recommended name:
ERC protein 2
Alternative name(s):
CAZ-associated structural protein 1
Short name:
CAST1
Gene namesi
Name:Erc2
Synonyms:Cast1, D14Ertd171e, Kiaa0378
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 14

Organism-specific databases

MGIiMGI:1098749. Erc2.

Subcellular locationi

GO - Cellular componenti

  • cell junction Source: UniProtKB-KW
  • cytoplasm Source: UniProtKB-SubCell
  • cytoskeleton Source: UniProtKB-SubCell
  • growth cone Source: UniProtKB
  • presynaptic active zone Source: InterPro
  • presynaptic membrane Source: UniProtKB
  • synapse Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cytoplasm, Cytoskeleton, Synapse, Synaptosome

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 957957ERC protein 2PRO_0000087003Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei65 – 651PhosphoserineCombined sources
Modified residuei666 – 6661PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ6PH08.
MaxQBiQ6PH08.
PaxDbiQ6PH08.
PeptideAtlasiQ6PH08.
PRIDEiQ6PH08.

PTM databases

iPTMnetiQ6PH08.
PhosphoSiteiQ6PH08.

Expressioni

Tissue specificityi

Expressed throughout the central nervous system, including hippocampus, cortex, cerebellum and olfactory bulb.1 Publication

Gene expression databases

BgeeiENSMUSG00000040640.
CleanExiMM_ERC2.
GenevisibleiQ6PH08. MM.

Interactioni

Subunit structurei

Interacts with BSN, ERC1, PPFIA1, PPFIA2, PPFIA3 and PPFIA4. Interacts through its C-terminus with the PDZ domain of RIMS1. Part of a complex consisting of ERC2, RIMS1 and UNC13A.

Protein-protein interaction databases

BioGridi232032. 1 interaction.
STRINGi10090.ENSMUSP00000087773.

Structurei

3D structure databases

ProteinModelPortaliQ6PH08.
SMRiQ6PH08. Positions 141-168.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili140 – 917778Sequence analysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi35 – 417Poly-Gly
Compositional biasi129 – 1335Poly-His
Compositional biasi879 – 8824Poly-Lys
Compositional biasi920 – 93213Poly-HisAdd
BLAST

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG4809. Eukaryota.
ENOG410Y4GU. LUCA.
GeneTreeiENSGT00650000093320.
HOGENOMiHOG000236353.
HOVERGENiHBG051496.
InParanoidiQ6PH08.
KOiK19878.
OMAiLMASETQ.
OrthoDBiEOG091G01EN.
PhylomeDBiQ6PH08.
TreeFamiTF324969.

Family and domain databases

InterProiIPR019323. ELKS/CAST.
[Graphical view]
PANTHERiPTHR18861. PTHR18861. 1 hit.
PfamiPF10174. Cast. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6PH08-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MYGSARTISN LEGSPSRSPR LPRSPRLGHR RTSSGGGGGT GKTLSMENIQ
60 70 80 90 100
SLNAAYATSG PMYLSDHEGV ASTTYPKGTM TLGRATNRAV YGGRVTAMGS
110 120 130 140 150
SPNIASAGLS HTDVLSYTDQ HGGLSGSSHH HHHQVPSMLR QVRDSTMLDL
160 170 180 190 200
QAQLKELQRE NDLLRKELDI KDSKLGSSMN SIKTFWSPEL KKERVLRKEE
210 220 230 240 250
AARMSVLKEQ MRVSHEENQH LQLTIQALQD ELRTQRDLNH LLQQESGNRG
260 270 280 290 300
AEHFTIELTE ENFRRLQAEH DRQAKELFLL RKTLEEMELR IETQKQTLNA
310 320 330 340 350
RDESIKKLLE MLQSKGLPSK SLEDDNERTR RMAEAESQVS HLEVILDQKE
360 370 380 390 400
KENIHLREEL HRRSQLQPEP AKTKALQTVI EMKDTKIASL ERNIRDLEDE
410 420 430 440 450
VQMLKANGVL NTEDREEEIK QIEVYKSHSK FMKTKIDQLK QELSKKESEL
460 470 480 490 500
LALQTKLETL SNQNSDCKQH IEVLKESLTA KEQRAAILQT EVDALRLRLE
510 520 530 540 550
EKESFLNKKT KQLQDLTEEK GTLAGEIRDM KDMLEVKERK INVLQKKIEN
560 570 580 590 600
LQEQLRDKDK QLTNLKDRVK SLQTDSSNTD TALATLEEAL SEKERIIERL
610 620 630 640 650
KEQRERDDRE RLEEIESFRK ENKDLKEKVN ALQAELTEKE SSLIDLKEHA
660 670 680 690 700
SSLASAGLKR DSKLKSLEIA IEQKKEECNK LEAQLKKAHN IEDDSRMNPE
710 720 730 740 750
FADRLKQLDK EASYYRDECG KAQAEVDRLL EILKEVENEK NDKDKKIAEL
760 770 780 790 800
ESLTLRHMKD QNKKVANLKY NQQLEKKKNA QLLEEVRRRE DSMVDNSQHL
810 820 830 840 850
QIEELMNALE KTRQELDATK ARLASTQQSL AEKEAHLANL RIERRKQLEE
860 870 880 890 900
ILEMKQEALL AAISEKDANI ALLELSASKK KKTQEEVMAL KREKDRLVHQ
910 920 930 940 950
LKQQTQNRMK LMADNYDEDH HHYHHHHHHH HHRSPGRSQH SNHRPSPDQD

DEEGIWA
Length:957
Mass (Da):110,639
Last modified:August 31, 2004 - v2
Checksum:i9476977763320323
GO
Isoform 2 (identifier: Q6PH08-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-325: Missing.
     326-358: NERTRRMAEAESQVSHLEVILDQKEKENIHLRE → MALNRSVQTCFCSKMPCEQQICSH

Show »
Length:623
Mass (Da):72,909
Checksum:iC23DFB38977E9AB5
GO
Isoform 3 (identifier: Q6PH08-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     752-755: Missing.
     950-957: DDEEGIWA → LSEGLDKRIAQHCSSILIIYCSLALLTIHQRRPAVAAGLKGRGVFAFTFLLNSVLLD

Show »
Length:1,002
Mass (Da):115,502
Checksum:i4F50674FD5D36831
GO
Isoform 4 (identifier: Q6PH08-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     219-219: Q → QLLDARRTK
     493-515: DALRLRLEEKESFLNKKTKQLQD → RHLLRYWRAGALSHIQCCSWETS
     516-957: Missing.

Note: Due to intron retention. No experimental confirmation available.
Show »
Length:523
Mass (Da):59,709
Checksum:i95058364DC7CCA87
GO

Sequence cautioni

The sequence BAC65547 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 325325Missing in isoform 2. CuratedVSP_012306Add
BLAST
Alternative sequencei219 – 2191Q → QLLDARRTK in isoform 4. 1 PublicationVSP_011466
Alternative sequencei326 – 35833NERTR…IHLRE → MALNRSVQTCFCSKMPCEQQ ICSH in isoform 2. CuratedVSP_011467Add
BLAST
Alternative sequencei493 – 51523DALRL…KQLQD → RHLLRYWRAGALSHIQCCSW ETS in isoform 4. 1 PublicationVSP_011468Add
BLAST
Alternative sequencei516 – 957442Missing in isoform 4. 1 PublicationVSP_011471Add
BLAST
Alternative sequencei752 – 7554Missing in isoform 3. 1 PublicationVSP_011469
Alternative sequencei950 – 9578DDEEGIWA → LSEGLDKRIAQHCSSILIIY CSLALLTIHQRRPAVAAGLK GRGVFAFTFLLNSVLLD in isoform 3. 1 PublicationVSP_011470

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK122265 mRNA. Translation: BAC65547.1. Different initiation.
AK032385 mRNA. Translation: BAC27848.1.
BC056760 mRNA. Translation: AAH56760.1.
CCDSiCCDS26887.1. [Q6PH08-3]
RefSeqiNP_808482.2. NM_177814.4. [Q6PH08-3]
XP_006519013.1. XM_006518950.2. [Q6PH08-2]
XP_011243353.1. XM_011245051.1. [Q6PH08-1]
UniGeneiMm.318004.

Genome annotation databases

EnsembliENSMUST00000090302; ENSMUSP00000087773; ENSMUSG00000040640. [Q6PH08-3]
GeneIDi238988.
KEGGimmu:238988.
UCSCiuc007sty.1. mouse. [Q6PH08-4]
uc007sua.1. mouse. [Q6PH08-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK122265 mRNA. Translation: BAC65547.1. Different initiation.
AK032385 mRNA. Translation: BAC27848.1.
BC056760 mRNA. Translation: AAH56760.1.
CCDSiCCDS26887.1. [Q6PH08-3]
RefSeqiNP_808482.2. NM_177814.4. [Q6PH08-3]
XP_006519013.1. XM_006518950.2. [Q6PH08-2]
XP_011243353.1. XM_011245051.1. [Q6PH08-1]
UniGeneiMm.318004.

3D structure databases

ProteinModelPortaliQ6PH08.
SMRiQ6PH08. Positions 141-168.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi232032. 1 interaction.
STRINGi10090.ENSMUSP00000087773.

PTM databases

iPTMnetiQ6PH08.
PhosphoSiteiQ6PH08.

Proteomic databases

EPDiQ6PH08.
MaxQBiQ6PH08.
PaxDbiQ6PH08.
PeptideAtlasiQ6PH08.
PRIDEiQ6PH08.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000090302; ENSMUSP00000087773; ENSMUSG00000040640. [Q6PH08-3]
GeneIDi238988.
KEGGimmu:238988.
UCSCiuc007sty.1. mouse. [Q6PH08-4]
uc007sua.1. mouse. [Q6PH08-3]

Organism-specific databases

CTDi26059.
MGIiMGI:1098749. Erc2.
RougeiSearch...

Phylogenomic databases

eggNOGiKOG4809. Eukaryota.
ENOG410Y4GU. LUCA.
GeneTreeiENSGT00650000093320.
HOGENOMiHOG000236353.
HOVERGENiHBG051496.
InParanoidiQ6PH08.
KOiK19878.
OMAiLMASETQ.
OrthoDBiEOG091G01EN.
PhylomeDBiQ6PH08.
TreeFamiTF324969.

Miscellaneous databases

ChiTaRSiErc2. mouse.
PROiQ6PH08.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000040640.
CleanExiMM_ERC2.
GenevisibleiQ6PH08. MM.

Family and domain databases

InterProiIPR019323. ELKS/CAST.
[Graphical view]
PANTHERiPTHR18861. PTHR18861. 1 hit.
PfamiPF10174. Cast. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiERC2_MOUSE
AccessioniPrimary (citable) accession number: Q6PH08
Secondary accession number(s): Q80U20, Q8CCP1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: August 31, 2004
Last modified: September 7, 2016
This is version 103 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.