Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dual specificity protein phosphatase CDC14B

Gene

Cdc14b

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Dual-specificity phosphatase involved in DNA damage response. Essential regulator of the G2 DNA damage checkpoint: following DNA damage, translocates to the nucleus and dephosphorylates FZR1/CDH1, a key activator of the anaphase promoting complex/cyclosome (APC/C). Dephosphorylates SIRT2 around early anaphase. Dephosphorylation of FZR1/CDH1 activates the APC/C, leading to the ubiquitination of PLK1, preventing entry into mitosis. Preferentially dephosphorylates proteins modified by proline-directed kinases (By similarity).By similarity

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.PROSITE-ProRule annotation
[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei314 – 3141Phosphocysteine intermediatePROSITE-ProRule annotation

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase

Keywords - Biological processi

DNA damage, DNA repair

Names & Taxonomyi

Protein namesi
Recommended name:
Dual specificity protein phosphatase CDC14B (EC:3.1.3.16, EC:3.1.3.48)
Alternative name(s):
CDC14 cell division cycle 14 homolog B
Gene namesi
Name:Cdc14b
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589 Componenti: Chromosome 13

Organism-specific databases

MGIiMGI:2441808. Cdc14b.

Subcellular locationi

  • Nucleusnucleolus By similarity
  • Nucleusnucleoplasm By similarity

  • Note: Following DNA damage, translocates from the nucleolus to the nucleoplasm and interacts with FZR1/CDH1.By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 485485Dual specificity protein phosphatase CDC14BPRO_0000094879Add
BLAST

Proteomic databases

PRIDEiQ6PFY9.

PTM databases

PhosphoSiteiQ6PFY9.

Expressioni

Gene expression databases

BgeeiQ6PFY9.
GenevisibleiQ6PFY9. MM.

Interactioni

Subunit structurei

Interacts with FZR1/CDH1.By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000046003.

Structurei

3D structure databases

ProteinModelPortaliQ6PFY9.
SMRiQ6PFY9. Positions 43-379.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni44 – 198155AAdd
BLAST
Regioni199 – 21214LinkerAdd
BLAST
Regioni213 – 379167BAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi1 – 5454Nucleolar localization signalBy similarityAdd
BLAST

Domaini

Composed of two structurally equivalent A and B domains that adopt a dual specificity protein phosphatase (DSP) fold.

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG2453.
GeneTreeiENSGT00390000010254.
HOGENOMiHOG000198341.
HOVERGENiHBG050818.
InParanoidiQ6PFY9.
KOiK06639.
OMAiYIPYFKN.
OrthoDBiEOG776SPM.
PhylomeDBiQ6PFY9.
TreeFamiTF101053.

Family and domain databases

Gene3Di3.90.190.10. 2 hits.
InterProiIPR029260. DSPn.
IPR000340. Dual-sp_phosphatase_cat-dom.
IPR020422. Dual-sp_phosphatase_subgr_cat.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR000387. Tyr/Dual-sp_Pase.
IPR016130. Tyr_Pase_AS.
[Graphical view]
PfamiPF00782. DSPc. 1 hit.
PF14671. DSPn. 1 hit.
[Graphical view]
SUPFAMiSSF52799. SSF52799. 2 hits.
PROSITEiPS00383. TYR_PHOSPHATASE_1. 1 hit.
PS50056. TYR_PHOSPHATASE_2. 1 hit.
PS50054. TYR_PHOSPHATASE_DUAL. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6PFY9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKRKSERRSA WATAPPCSRR SSSSSPGVKK SRSSTPQELH RLEQQDDLYL
60 70 80 90 100
DITDRLCFAI LYSRPKSATN EHYFSIDNEL EYENFYADFG PLNLAMVYRY
110 120 130 140 150
CCKINKKLKS ITMLRKKIIH FTGTDQRKQA NAAFLVGCYM VIYLGRTPED
160 170 180 190 200
AYRTLIFGDT AYIPFRDAAY GSCSFYITLL DCFHAVKKAM QYGFFNFNSF
210 220 230 240 250
NLDEYEHYEK AENGDFNWII PERFLAFCGP HSRSRLESGY HQHSPETYIP
260 270 280 290 300
YFKNHNVTTI IRLNKRMYDA KRFTDAGFDH HDLFFPDGST PAESIVQEFL
310 320 330 340 350
DICENVKGAI AVHCKAGLGR TGTLIGCYLM KHYRMTAAES IAWLRICRPG
360 370 380 390 400
SVIGPQQQFL VMKQSSLWLE GDYFRQKLRG QENGPLREAF SKHLSDADDL
410 420 430 440 450
SLNGLENQDN QEPEPYSDDD EVSGMTQGDR LRALKSRRQP KASAIPLTCP
460 470 480
LAVLTSALCS VAIWWIVCDY ILPTLLFCLD GFRTQ
Length:485
Mass (Da):55,661
Last modified:July 5, 2004 - v1
Checksum:i8963E14648FC89DA
GO
Isoform 2 (identifier: Q6PFY9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: MKRKSERRSAWATAPPCSRRSSSSSPGVKKSRSSTPQELHRLEQQDDLYLDIT → MRREGAGTPLMAEVIR

Show »
Length:448
Mass (Da):51,402
Checksum:iC18E8112A217EBE6
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti136 – 1361V → I in AAH49794 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5353MKRKS…YLDIT → MRREGAGTPLMAEVIR in isoform 2. 1 PublicationVSP_012325Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK041155 mRNA. Translation: BAC30842.1.
BC049794 mRNA. Translation: AAH49794.1.
BC057357 mRNA. Translation: AAH57357.1.
CCDSiCCDS26598.1. [Q6PFY9-1]
CCDS49292.1. [Q6PFY9-2]
RefSeqiNP_001116461.1. NM_001122989.1. [Q6PFY9-2]
NP_766175.3. NM_172587.3. [Q6PFY9-1]
XP_006517287.1. XM_006517224.2. [Q6PFY9-1]
XP_011242816.1. XM_011244514.1. [Q6PFY9-1]
UniGeneiMm.25335.

Genome annotation databases

EnsembliENSMUST00000039318; ENSMUSP00000046003; ENSMUSG00000033102. [Q6PFY9-1]
ENSMUST00000109769; ENSMUSP00000105391; ENSMUSG00000033102. [Q6PFY9-2]
ENSMUST00000109770; ENSMUSP00000105392; ENSMUSG00000033102. [Q6PFY9-1]
GeneIDi218294.
KEGGimmu:218294.
UCSCiuc007qym.2. mouse. [Q6PFY9-1]
uc007qyo.2. mouse. [Q6PFY9-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK041155 mRNA. Translation: BAC30842.1.
BC049794 mRNA. Translation: AAH49794.1.
BC057357 mRNA. Translation: AAH57357.1.
CCDSiCCDS26598.1. [Q6PFY9-1]
CCDS49292.1. [Q6PFY9-2]
RefSeqiNP_001116461.1. NM_001122989.1. [Q6PFY9-2]
NP_766175.3. NM_172587.3. [Q6PFY9-1]
XP_006517287.1. XM_006517224.2. [Q6PFY9-1]
XP_011242816.1. XM_011244514.1. [Q6PFY9-1]
UniGeneiMm.25335.

3D structure databases

ProteinModelPortaliQ6PFY9.
SMRiQ6PFY9. Positions 43-379.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000046003.

PTM databases

PhosphoSiteiQ6PFY9.

Proteomic databases

PRIDEiQ6PFY9.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000039318; ENSMUSP00000046003; ENSMUSG00000033102. [Q6PFY9-1]
ENSMUST00000109769; ENSMUSP00000105391; ENSMUSG00000033102. [Q6PFY9-2]
ENSMUST00000109770; ENSMUSP00000105392; ENSMUSG00000033102. [Q6PFY9-1]
GeneIDi218294.
KEGGimmu:218294.
UCSCiuc007qym.2. mouse. [Q6PFY9-1]
uc007qyo.2. mouse. [Q6PFY9-2]

Organism-specific databases

CTDi8555.
MGIiMGI:2441808. Cdc14b.

Phylogenomic databases

eggNOGiCOG2453.
GeneTreeiENSGT00390000010254.
HOGENOMiHOG000198341.
HOVERGENiHBG050818.
InParanoidiQ6PFY9.
KOiK06639.
OMAiYIPYFKN.
OrthoDBiEOG776SPM.
PhylomeDBiQ6PFY9.
TreeFamiTF101053.

Miscellaneous databases

NextBioi376235.
PROiQ6PFY9.
SOURCEiSearch...

Gene expression databases

BgeeiQ6PFY9.
GenevisibleiQ6PFY9. MM.

Family and domain databases

Gene3Di3.90.190.10. 2 hits.
InterProiIPR029260. DSPn.
IPR000340. Dual-sp_phosphatase_cat-dom.
IPR020422. Dual-sp_phosphatase_subgr_cat.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR000387. Tyr/Dual-sp_Pase.
IPR016130. Tyr_Pase_AS.
[Graphical view]
PfamiPF00782. DSPc. 1 hit.
PF14671. DSPn. 1 hit.
[Graphical view]
SUPFAMiSSF52799. SSF52799. 2 hits.
PROSITEiPS00383. TYR_PHOSPHATASE_1. 1 hit.
PS50056. TYR_PHOSPHATASE_2. 1 hit.
PS50054. TYR_PHOSPHATASE_DUAL. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: C57BL/6J.
    Tissue: Aorta and Vein.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6.
    Tissue: Brain and Limb.

Entry informationi

Entry nameiCC14B_MOUSE
AccessioniPrimary (citable) accession number: Q6PFY9
Secondary accession number(s): Q80WC4, Q8BLV5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 23, 2004
Last sequence update: July 5, 2004
Last modified: July 22, 2015
This is version 100 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.