Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

tRNA methyltransferase 10 homolog B

Gene

TRMT10B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

S-adenosyl-L-methionine-dependent guanine N1-methyltransferase that catalyzes the formation of N1-methylguanine at position 9 (m1G9) in tRNAs (PubMed:23042678). Probably not able to catalyze formation of N1-methyladenine at position 9 (m1A9) in tRNAs (PubMed:23042678).1 Publication

Caution

Catalytic activityi

S-adenosyl-L-methionine + guanine9 in tRNA = S-adenosyl-L-homocysteine + N1-methylguanine9 in tRNA.1 Publication

GO - Molecular functioni

Keywordsi

Molecular functionMethyltransferase, Transferase
LigandS-adenosyl-L-methionine

Names & Taxonomyi

Protein namesi
Recommended name:
tRNA methyltransferase 10 homolog B (EC:2.1.1.2211 Publication)
Alternative name(s):
RNA (guanine-9-)-methyltransferase domain-containing protein 3
tRNA (guanine(9)-N(1))-methyltransferase TRMT10B
Gene namesi
Name:TRMT10B
Synonyms:RG9MTD3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

EuPathDBiHostDB:ENSG00000165275.9
HGNCiHGNC:26454 TRMT10B
neXtProtiNX_Q6PF06

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000165275
PharmGKBiPA134938884

Polymorphism and mutation databases

DMDMi74749176

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003113211 – 316tRNA methyltransferase 10 homolog BAdd BLAST316

Proteomic databases

PaxDbiQ6PF06
PeptideAtlasiQ6PF06
PRIDEiQ6PF06

PTM databases

iPTMnetiQ6PF06
PhosphoSitePlusiQ6PF06

Expressioni

Gene expression databases

BgeeiENSG00000165275
CleanExiHS_RG9MTD3
ExpressionAtlasiQ6PF06 baseline and differential
GenevisibleiQ6PF06 HS

Organism-specific databases

HPAiHPA021800

Interactioni

Protein-protein interaction databases

BioGridi12765934 interactors.
IntActiQ6PF06 2 interactors.
STRINGi9606.ENSP00000297994

Structurei

3D structure databases

ProteinModelPortaliQ6PF06
SMRiQ6PF06
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini113 – 310SAM-dependent MTase TRM10-typePROSITE-ProRule annotationAdd BLAST198

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili73 – 97Sequence analysisAdd BLAST25

Sequence similaritiesi

Belongs to the class IV-like SAM-binding methyltransferase superfamily. TRM10 family.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG2967 Eukaryota
ENOG4111JE4 LUCA
GeneTreeiENSGT00530000063169
HOGENOMiHOG000006897
HOVERGENiHBG105959
InParanoidiQ6PF06
KOiK15445
OMAiNFHSKIL
OrthoDBiEOG091G0KYM
PhylomeDBiQ6PF06
TreeFamiTF330972

Family and domain databases

Gene3Di3.40.1280.301 hit
InterProiView protein in InterPro
IPR028564 MT_TRM10-typ
IPR038459 MT_TRM10-typ_sf
IPR007356 tRNA_m1G_MeTrfase_euk
IPR016009 tRNA_MeTrfase_TRMD/TRM10
PANTHERiPTHR13563 PTHR13563, 1 hit
PfamiView protein in Pfam
PF01746 tRNA_m1G_MT, 1 hit
PROSITEiView protein in PROSITE
PS51675 SAM_MT_TRM10, 1 hit

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6PF06-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDWKLEGSTQ KVESPVLQGQ EGILEETGED GLPEGFQLLQ IDAEGECQEG
60 70 80 90 100
EILATGSTAW CSKNVQRKQR HWEKIVAAKK SKRKQEKERR KANRAENPGI
110 120 130 140 150
CPQHSKRFLR ALTKDKLLEA KHSGPRLCID LSMTHYMSKK ELSRLAGQIR
160 170 180 190 200
RLYGSNKKAD RPFWICLTGF TTDSPLYEEC VRMNDGFSSY LLDITEEDCF
210 220 230 240 250
SLFPLETLVY LTPDSEHALE DVDLNKVYIL GGLVDESIQK KVTFQKAREY
260 270 280 290 300
SVKTARLPIQ EYMVRNQNGK NYHSEILAIN QVFDILSTYL ETHNWPEALK
310
KGVSSGKGYI LRNSVE
Length:316
Mass (Da):36,124
Last modified:July 5, 2004 - v1
Checksum:iE65D2C5F89FCB8C5
GO
Isoform 2 (identifier: Q6PF06-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-98: MDWKLEGSTQ...RRKANRAENP → MVL

Note: No experimental confirmation available.
Show »
Length:221
Mass (Da):25,379
Checksum:iBD74B2D3A6F70EEA
GO
Isoform 5 (identifier: Q6PF06-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     141-191: Missing.
     282-290: Missing.

Show »
Length:256
Mass (Da):29,183
Checksum:iCD4E4822D2784591
GO
Isoform 3 (identifier: Q6PF06-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     141-174: ELSRLAGQIRRLYGSNKKADRPFWICLTGFTTDS → VEHPLSLEFLLAMREAQKGTAFRRIWSTPASGIP
     175-316: Missing.

Note: No experimental confirmation available.
Show »
Length:174
Mass (Da):19,721
Checksum:iA7B2FD8ED6038B63
GO
Isoform 4 (identifier: Q6PF06-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-140: Missing.
     282-290: Missing.

Note: No experimental confirmation available.
Show »
Length:229
Mass (Da):25,813
Checksum:iEFF8B82C1995BA30
GO

Sequence cautioni

The sequence BAB71074 differs from that shown. Reason: Erroneous termination at position 317. Translated as stop.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti106K → E in BAC03957 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_037224234V → G. Corresponds to variant dbSNP:rs36023446Ensembl.1
Natural variantiVAR_037225242V → A. Corresponds to variant dbSNP:rs12337034Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0295191 – 98MDWKL…RAENP → MVL in isoform 2. 1 PublicationAdd BLAST98
Alternative sequenceiVSP_05465263 – 140Missing in isoform 4. 1 PublicationAdd BLAST78
Alternative sequenceiVSP_055735141 – 191Missing in isoform 5. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_029520141 – 174ELSRL…FTTDS → VEHPLSLEFLLAMREAQKGT AFRRIWSTPASGIP in isoform 3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_029521175 – 316Missing in isoform 3. 1 PublicationAdd BLAST142
Alternative sequenceiVSP_054653282 – 290Missing in isoform 4 and isoform 5. 1 Publication9

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056017 mRNA Translation: BAB71074.1 Sequence problems.
AK092718 mRNA Translation: BAC03957.1
AK294219 mRNA Translation: BAH11702.1
AK295733 mRNA Translation: BAH12169.1
AL138752 Genomic DNA No translation available.
AL591470 Genomic DNA No translation available.
CH471071 Genomic DNA Translation: EAW58267.1
CH471071 Genomic DNA Translation: EAW58268.1
CH471071 Genomic DNA Translation: EAW58269.1
BC012175 mRNA Translation: AAH12175.1
BC057774 mRNA Translation: AAH57774.1
CCDSiCCDS43804.1 [Q6PF06-1]
CCDS69598.1 [Q6PF06-5]
CCDS69600.1 [Q6PF06-4]
CCDS69601.1 [Q6PF06-2]
RefSeqiNP_001273879.1, NM_001286950.1 [Q6PF06-5]
NP_001273880.1, NM_001286951.1 [Q6PF06-2]
NP_001273881.1, NM_001286952.1 [Q6PF06-4]
NP_001273882.1, NM_001286953.1
NP_001273883.1, NM_001286954.1
NP_659401.2, NM_144964.3
UniGeneiHs.655614

Genome annotation databases

EnsembliENST00000297994; ENSP00000297994; ENSG00000165275 [Q6PF06-1]
ENST00000377753; ENSP00000366982; ENSG00000165275 [Q6PF06-4]
ENST00000377754; ENSP00000366983; ENSG00000165275 [Q6PF06-2]
ENST00000488673; ENSP00000437395; ENSG00000165275 [Q6PF06-3]
ENST00000537911; ENSP00000444997; ENSG00000165275 [Q6PF06-5]
GeneIDi158234
KEGGihsa:158234
UCSCiuc004aai.5 human [Q6PF06-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiTM10B_HUMAN
AccessioniPrimary (citable) accession number: Q6PF06
Secondary accession number(s): B7Z216
, B7Z3D3, Q05DJ4, Q5QP83, Q8NAG2, Q96N36
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: July 5, 2004
Last modified: April 25, 2018
This is version 114 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome