Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

tRNA methyltransferase 10 homolog B

Gene

TRMT10B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Probable RNA methyltransferase.By similarity

GO - Molecular functioni

Complete GO annotation...

Keywords - Molecular functioni

Methyltransferase, Transferase

Keywords - Ligandi

S-adenosyl-L-methionine

Names & Taxonomyi

Protein namesi
Recommended name:
tRNA methyltransferase 10 homolog B (EC:2.1.1.-)
Alternative name(s):
RNA (guanine-9-)-methyltransferase domain-containing protein 3
Gene namesi
Name:TRMT10B
Synonyms:RG9MTD3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

HGNCiHGNC:26454. TRMT10B.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134938884.

Polymorphism and mutation databases

DMDMi74749176.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 316316tRNA methyltransferase 10 homolog BPRO_0000311321Add
BLAST

Proteomic databases

PaxDbiQ6PF06.
PRIDEiQ6PF06.

PTM databases

PhosphoSiteiQ6PF06.

Expressioni

Gene expression databases

BgeeiQ6PF06.
CleanExiHS_RG9MTD3.
ExpressionAtlasiQ6PF06. baseline and differential.
GenevisibleiQ6PF06. HS.

Organism-specific databases

HPAiHPA021800.

Interactioni

Protein-protein interaction databases

BioGridi127659. 32 interactions.
IntActiQ6PF06. 1 interaction.
STRINGi9606.ENSP00000297994.

Structurei

3D structure databases

ProteinModelPortaliQ6PF06.
SMRiQ6PF06. Positions 122-299.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini113 – 310198SAM-dependent MTase TRM10-typePROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili73 – 9725Sequence analysisAdd
BLAST

Sequence similaritiesi

Belongs to the class IV-like SAM-binding methyltransferase superfamily. TRM10 family.PROSITE-ProRule annotation
Contains 1 SAM-dependent MTase TRM10-type domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG2967. Eukaryota.
ENOG4111JE4. LUCA.
GeneTreeiENSGT00530000063169.
HOGENOMiHOG000006897.
HOVERGENiHBG105959.
InParanoidiQ6PF06.
OMAiNSGICPQ.
PhylomeDBiQ6PF06.
TreeFamiTF330972.

Family and domain databases

InterProiIPR028564. MT_TRM10-typ.
IPR007356. tRNA_m1G_MeTrfase_euk.
IPR016009. tRNA_MeTrfase_TRMD/TRM10.
[Graphical view]
PANTHERiPTHR13563. PTHR13563. 1 hit.
PfamiPF01746. tRNA_m1G_MT. 1 hit.
[Graphical view]
PROSITEiPS51675. SAM_MT_TRM10. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6PF06-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDWKLEGSTQ KVESPVLQGQ EGILEETGED GLPEGFQLLQ IDAEGECQEG
60 70 80 90 100
EILATGSTAW CSKNVQRKQR HWEKIVAAKK SKRKQEKERR KANRAENPGI
110 120 130 140 150
CPQHSKRFLR ALTKDKLLEA KHSGPRLCID LSMTHYMSKK ELSRLAGQIR
160 170 180 190 200
RLYGSNKKAD RPFWICLTGF TTDSPLYEEC VRMNDGFSSY LLDITEEDCF
210 220 230 240 250
SLFPLETLVY LTPDSEHALE DVDLNKVYIL GGLVDESIQK KVTFQKAREY
260 270 280 290 300
SVKTARLPIQ EYMVRNQNGK NYHSEILAIN QVFDILSTYL ETHNWPEALK
310
KGVSSGKGYI LRNSVE
Length:316
Mass (Da):36,124
Last modified:July 5, 2004 - v1
Checksum:iE65D2C5F89FCB8C5
GO
Isoform 2 (identifier: Q6PF06-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-98: MDWKLEGSTQ...RRKANRAENP → MVL

Note: No experimental confirmation available.
Show »
Length:221
Mass (Da):25,379
Checksum:iBD74B2D3A6F70EEA
GO
Isoform 5 (identifier: Q6PF06-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     141-191: Missing.
     282-290: Missing.

Show »
Length:256
Mass (Da):29,183
Checksum:iCD4E4822D2784591
GO
Isoform 3 (identifier: Q6PF06-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     141-174: ELSRLAGQIRRLYGSNKKADRPFWICLTGFTTDS → VEHPLSLEFLLAMREAQKGTAFRRIWSTPASGIP
     175-316: Missing.

Note: No experimental confirmation available.
Show »
Length:174
Mass (Da):19,721
Checksum:iA7B2FD8ED6038B63
GO
Isoform 4 (identifier: Q6PF06-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-140: Missing.
     282-290: Missing.

Note: No experimental confirmation available.
Show »
Length:229
Mass (Da):25,813
Checksum:iEFF8B82C1995BA30
GO

Sequence cautioni

The sequence BAB71074.1 differs from that shown. Reason: Erroneous termination at position 317. Translated as stop.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti106 – 1061K → E in BAC03957 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti234 – 2341V → G.
Corresponds to variant rs36023446 [ dbSNP | Ensembl ].
VAR_037224
Natural varianti242 – 2421V → A.
Corresponds to variant rs12337034 [ dbSNP | Ensembl ].
VAR_037225

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 9898MDWKL…RAENP → MVL in isoform 2. 1 PublicationVSP_029519Add
BLAST
Alternative sequencei63 – 14078Missing in isoform 4. 1 PublicationVSP_054652Add
BLAST
Alternative sequencei141 – 19151Missing in isoform 5. 1 PublicationVSP_055735Add
BLAST
Alternative sequencei141 – 17434ELSRL…FTTDS → VEHPLSLEFLLAMREAQKGT AFRRIWSTPASGIP in isoform 3. 1 PublicationVSP_029520Add
BLAST
Alternative sequencei175 – 316142Missing in isoform 3. 1 PublicationVSP_029521Add
BLAST
Alternative sequencei282 – 2909Missing in isoform 4 and isoform 5. 1 PublicationVSP_054653

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056017 mRNA. Translation: BAB71074.1. Sequence problems.
AK092718 mRNA. Translation: BAC03957.1.
AK294219 mRNA. Translation: BAH11702.1.
AK295733 mRNA. Translation: BAH12169.1.
AL138752 Genomic DNA. No translation available.
AL591470 Genomic DNA. No translation available.
CH471071 Genomic DNA. Translation: EAW58267.1.
CH471071 Genomic DNA. Translation: EAW58268.1.
CH471071 Genomic DNA. Translation: EAW58269.1.
BC012175 mRNA. Translation: AAH12175.1.
BC057774 mRNA. Translation: AAH57774.1.
CCDSiCCDS43804.1. [Q6PF06-1]
CCDS69598.1. [Q6PF06-5]
CCDS69600.1. [Q6PF06-4]
CCDS69601.1. [Q6PF06-2]
RefSeqiNP_001273879.1. NM_001286950.1. [Q6PF06-5]
NP_001273880.1. NM_001286951.1. [Q6PF06-2]
NP_001273881.1. NM_001286952.1. [Q6PF06-4]
NP_001273882.1. NM_001286953.1.
NP_001273883.1. NM_001286954.1.
NP_659401.2. NM_144964.3.
UniGeneiHs.655614.

Genome annotation databases

EnsembliENST00000297994; ENSP00000297994; ENSG00000165275. [Q6PF06-1]
ENST00000377753; ENSP00000366982; ENSG00000165275. [Q6PF06-4]
ENST00000377754; ENSP00000366983; ENSG00000165275. [Q6PF06-2]
ENST00000488673; ENSP00000437395; ENSG00000165275. [Q6PF06-3]
ENST00000537911; ENSP00000444997; ENSG00000165275. [Q6PF06-5]
GeneIDi158234.
KEGGihsa:158234.
UCSCiuc004aai.5. human. [Q6PF06-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056017 mRNA. Translation: BAB71074.1. Sequence problems.
AK092718 mRNA. Translation: BAC03957.1.
AK294219 mRNA. Translation: BAH11702.1.
AK295733 mRNA. Translation: BAH12169.1.
AL138752 Genomic DNA. No translation available.
AL591470 Genomic DNA. No translation available.
CH471071 Genomic DNA. Translation: EAW58267.1.
CH471071 Genomic DNA. Translation: EAW58268.1.
CH471071 Genomic DNA. Translation: EAW58269.1.
BC012175 mRNA. Translation: AAH12175.1.
BC057774 mRNA. Translation: AAH57774.1.
CCDSiCCDS43804.1. [Q6PF06-1]
CCDS69598.1. [Q6PF06-5]
CCDS69600.1. [Q6PF06-4]
CCDS69601.1. [Q6PF06-2]
RefSeqiNP_001273879.1. NM_001286950.1. [Q6PF06-5]
NP_001273880.1. NM_001286951.1. [Q6PF06-2]
NP_001273881.1. NM_001286952.1. [Q6PF06-4]
NP_001273882.1. NM_001286953.1.
NP_001273883.1. NM_001286954.1.
NP_659401.2. NM_144964.3.
UniGeneiHs.655614.

3D structure databases

ProteinModelPortaliQ6PF06.
SMRiQ6PF06. Positions 122-299.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127659. 32 interactions.
IntActiQ6PF06. 1 interaction.
STRINGi9606.ENSP00000297994.

PTM databases

PhosphoSiteiQ6PF06.

Polymorphism and mutation databases

DMDMi74749176.

Proteomic databases

PaxDbiQ6PF06.
PRIDEiQ6PF06.

Protocols and materials databases

DNASUi158234.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000297994; ENSP00000297994; ENSG00000165275. [Q6PF06-1]
ENST00000377753; ENSP00000366982; ENSG00000165275. [Q6PF06-4]
ENST00000377754; ENSP00000366983; ENSG00000165275. [Q6PF06-2]
ENST00000488673; ENSP00000437395; ENSG00000165275. [Q6PF06-3]
ENST00000537911; ENSP00000444997; ENSG00000165275. [Q6PF06-5]
GeneIDi158234.
KEGGihsa:158234.
UCSCiuc004aai.5. human. [Q6PF06-1]

Organism-specific databases

CTDi158234.
GeneCardsiTRMT10B.
HGNCiHGNC:26454. TRMT10B.
HPAiHPA021800.
neXtProtiNX_Q6PF06.
PharmGKBiPA134938884.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2967. Eukaryota.
ENOG4111JE4. LUCA.
GeneTreeiENSGT00530000063169.
HOGENOMiHOG000006897.
HOVERGENiHBG105959.
InParanoidiQ6PF06.
OMAiNSGICPQ.
PhylomeDBiQ6PF06.
TreeFamiTF330972.

Miscellaneous databases

GenomeRNAii158234.
NextBioi35478880.
PROiQ6PF06.

Gene expression databases

BgeeiQ6PF06.
CleanExiHS_RG9MTD3.
ExpressionAtlasiQ6PF06. baseline and differential.
GenevisibleiQ6PF06. HS.

Family and domain databases

InterProiIPR028564. MT_TRM10-typ.
IPR007356. tRNA_m1G_MeTrfase_euk.
IPR016009. tRNA_MeTrfase_TRMD/TRM10.
[Graphical view]
PANTHERiPTHR13563. PTHR13563. 1 hit.
PfamiPF01746. tRNA_m1G_MT. 1 hit.
[Graphical view]
PROSITEiPS51675. SAM_MT_TRM10. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 4 AND 5).
    Tissue: Amygdala, Hippocampus, Neuroblastoma and Teratocarcinoma.
  2. "DNA sequence and analysis of human chromosome 9."
    Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
    , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
    Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: Eye and Placenta.

Entry informationi

Entry nameiTM10B_HUMAN
AccessioniPrimary (citable) accession number: Q6PF06
Secondary accession number(s): B7Z216
, B7Z3D3, Q05DJ4, Q5QP83, Q8NAG2, Q96N36
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: July 5, 2004
Last modified: March 16, 2016
This is version 100 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.