Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tetratricopeptide repeat protein 23-like

Gene

TTC23L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

GO - Biological processi

  • response to endoplasmic reticulum stress Source: ParkinsonsUK-UCL
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Tetratricopeptide repeat protein 23-like
Gene namesi
Name:TTC23L
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:26355. TTC23L.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162407169.

Polymorphism and mutation databases

BioMutaiTTC23L.
DMDMi189041194.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 361361Tetratricopeptide repeat protein 23-likePRO_0000336080Add
BLAST

Proteomic databases

PaxDbiQ6PF05.
PRIDEiQ6PF05.

PTM databases

PhosphoSiteiQ6PF05.

Expressioni

Gene expression databases

BgeeiQ6PF05.
CleanExiHS_TTC23L.
ExpressionAtlasiQ6PF05. baseline and differential.
GenevisibleiQ6PF05. HS.

Organism-specific databases

HPAiHPA037807.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
P0C2063EBI-8656864,EBI-9675596From a different organism.
CBY1Q9Y3M23EBI-10182647,EBI-947308
CTAGE5O153203EBI-10182647,EBI-1050253
EGLN3Q9H6Z93EBI-10182647,EBI-1175354
EXOC5Q8IW243EBI-10182647,EBI-10171392
taxP140793EBI-8656864,EBI-9675698From a different organism.

Protein-protein interaction databases

BioGridi127509. 8 interactions.
IntActiQ6PF05. 7 interactions.
STRINGi9606.ENSP00000422188.

Structurei

3D structure databases

ProteinModelPortaliQ6PF05.
SMRiQ6PF05. Positions 215-241.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili67 – 9529Sequence analysisAdd
BLAST
Coiled coili176 – 20934Sequence analysisAdd
BLAST
Coiled coili256 – 28328Sequence analysisAdd
BLAST

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IJRU. Eukaryota.
ENOG410XVCY. LUCA.
GeneTreeiENSGT00530000063847.
HOGENOMiHOG000154700.
HOVERGENiHBG108608.
InParanoidiQ6PF05.
OMAiCREAYFN.
OrthoDBiEOG75XGNF.
PhylomeDBiQ6PF05.
TreeFamiTF332604.

Family and domain databases

Gene3Di1.25.40.10. 1 hit.
InterProiIPR011990. TPR-like_helical_dom.
[Graphical view]
SUPFAMiSSF48452. SSF48452. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6PF05-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQASPIRIPT VSNDIDWDFC FHMSQQTEIP AHQQTDELYP TGGCGESEEE
60 70 80 90 100
TKAKEKEKAI DCMSHPKEKL AQSQKKVAQL IKEKMNTQAN KELIRCVILS
110 120 130 140 150
RIIFGDHHWK CARALANLAY GYLTLRGLPV QAKKHATSAK NTLLTWKANT
160 170 180 190 200
TSNKEKEEIL EALVKLYYTL GVAWLLQNRG REAYFNLQKA ERNMKELKEL
210 220 230 240 250
YKGGVCELQV SENDLTLALG RASLAIHRLN LALAYFEKAI GDVIAAKGDR
260 270 280 290 300
TSDLISLYEE AAQIEQLRRN HNQAIQYLQQ AHSVCVSLFT EVSPKTAEMS
310 320 330 340 350
ALLAKAYAMS GEAQHRDAVE IYFIRSINAY RATLGSEDFE TLSTTEEFCK
360
WLVQNGEKQD K
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Length:361
Mass (Da):40,837
Last modified:May 20, 2008 - v2
Checksum:i7CF14641AD301D40
GO
Isoform 2 (identifier: Q6PF05-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     281-287: AHSVCVS → MLLRYIS
     288-361: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:287
Mass (Da):32,681
Checksum:i4108DAE482B62BB0
GO
Isoform 3 (identifier: Q6PF05-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     359-361: QDK → QIFQKRRYKHDHKRHEKMFNPISHRGNANENHHTDTRVV

Note: No experimental confirmation available.
Show »
Length:397
Mass (Da):45,311
Checksum:iB70A83133174F2BF
GO

Sequence cautioni

The sequence AK097766 differs from that shown. Reason: Frameshift at position 52. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti115 – 1151L → P in BAB71699 (PubMed:14702039).Curated
Sequence conflicti171 – 1711G → A in AK097766 (PubMed:14702039).Curated
Sequence conflicti271 – 2711H → Y in AAR92152 (Ref. 3) Curated
Sequence conflicti287 – 2871S → P in AK097766 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti22 – 221H → R.1 Publication
Corresponds to variant rs6451173 [ dbSNP | Ensembl ].
VAR_043539
Natural varianti67 – 671K → E.
Corresponds to variant rs6866035 [ dbSNP | Ensembl ].
VAR_043540
Natural varianti150 – 1501T → M.
Corresponds to variant rs34566695 [ dbSNP | Ensembl ].
VAR_043541
Natural varianti153 – 1531N → D.
Corresponds to variant rs35769440 [ dbSNP | Ensembl ].
VAR_043542
Natural varianti247 – 2471K → N.
Corresponds to variant rs34702907 [ dbSNP | Ensembl ].
VAR_043543
Natural varianti325 – 3251R → K.
Corresponds to variant rs35665026 [ dbSNP | Ensembl ].
VAR_043544

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei281 – 2877AHSVCVS → MLLRYIS in isoform 2. 1 PublicationVSP_033814
Alternative sequencei288 – 36174Missing in isoform 2. 1 PublicationVSP_033815Add
BLAST
Alternative sequencei359 – 3613QDK → QIFQKRRYKHDHKRHEKMFN PISHRGNANENHHTDTRVV in isoform 3. 1 PublicationVSP_033816

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
JN799997 mRNA. Translation: AER93257.1.
AK058168 mRNA. Translation: BAB71699.1.
AK097766 mRNA. No translation available.
AY498865 mRNA. Translation: AAR92152.1.
AC026801 Genomic DNA. No translation available.
BC057775 mRNA. Translation: AAH57775.1.
CCDSiCCDS54840.1. [Q6PF05-1]
RefSeqiNP_001304878.1. NM_001317949.1.
NP_653326.3. NM_144725.3. [Q6PF05-1]
UniGeneiHs.435742.

Genome annotation databases

EnsembliENST00000502674; ENSP00000425242; ENSG00000205838. [Q6PF05-2]
ENST00000505624; ENSP00000422188; ENSG00000205838. [Q6PF05-1]
ENST00000610313; ENSP00000484792; ENSG00000205838. [Q6PF05-2]
GeneIDi153657.
KEGGihsa:153657.
UCSCiuc003jiu.4. human. [Q6PF05-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
JN799997 mRNA. Translation: AER93257.1.
AK058168 mRNA. Translation: BAB71699.1.
AK097766 mRNA. No translation available.
AY498865 mRNA. Translation: AAR92152.1.
AC026801 Genomic DNA. No translation available.
BC057775 mRNA. Translation: AAH57775.1.
CCDSiCCDS54840.1. [Q6PF05-1]
RefSeqiNP_001304878.1. NM_001317949.1.
NP_653326.3. NM_144725.3. [Q6PF05-1]
UniGeneiHs.435742.

3D structure databases

ProteinModelPortaliQ6PF05.
SMRiQ6PF05. Positions 215-241.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127509. 8 interactions.
IntActiQ6PF05. 7 interactions.
STRINGi9606.ENSP00000422188.

PTM databases

PhosphoSiteiQ6PF05.

Polymorphism and mutation databases

BioMutaiTTC23L.
DMDMi189041194.

Proteomic databases

PaxDbiQ6PF05.
PRIDEiQ6PF05.

Protocols and materials databases

DNASUi153657.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000502674; ENSP00000425242; ENSG00000205838. [Q6PF05-2]
ENST00000505624; ENSP00000422188; ENSG00000205838. [Q6PF05-1]
ENST00000610313; ENSP00000484792; ENSG00000205838. [Q6PF05-2]
GeneIDi153657.
KEGGihsa:153657.
UCSCiuc003jiu.4. human. [Q6PF05-1]

Organism-specific databases

CTDi153657.
GeneCardsiTTC23L.
HGNCiHGNC:26355. TTC23L.
HPAiHPA037807.
MIMi616344. gene.
neXtProtiNX_Q6PF05.
PharmGKBiPA162407169.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IJRU. Eukaryota.
ENOG410XVCY. LUCA.
GeneTreeiENSGT00530000063847.
HOGENOMiHOG000154700.
HOVERGENiHBG108608.
InParanoidiQ6PF05.
OMAiCREAYFN.
OrthoDBiEOG75XGNF.
PhylomeDBiQ6PF05.
TreeFamiTF332604.

Miscellaneous databases

GenomeRNAii153657.
PROiQ6PF05.
SOURCEiSearch...

Gene expression databases

BgeeiQ6PF05.
CleanExiHS_TTC23L.
ExpressionAtlasiQ6PF05. baseline and differential.
GenevisibleiQ6PF05. HS.

Family and domain databases

Gene3Di1.25.40.10. 1 hit.
InterProiIPR011990. TPR-like_helical_dom.
[Graphical view]
SUPFAMiSSF48452. SSF48452. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "FLJ25439, a novel cytokinesis-associated protein, induces tetraploidization and maintains chromosomal stability via enhancing expression of endoplasmic reticulum stress chaperones."
    Pan T.L., Hsu S.Y., Wang P.W., Cheng Y.T., Chang Y.C., Saha S., Hu J., Ouyang P.
    Cell Cycle 14:1174-1187(2015) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-22, SUBCELLULAR LOCATION.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANT ARG-22.
    Tissue: Testis.
  3. Li H., Ke R., Zhong G., Zhou G., Shen C., Lin L., Yang S.
    Submitted (DEC-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  4. "The DNA sequence and comparative analysis of human chromosome 5."
    Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
    , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
    Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.

Entry informationi

Entry nameiTT23L_HUMAN
AccessioniPrimary (citable) accession number: Q6PF05
Secondary accession number(s): G8IJH6
, Q6RGS4, Q8N7R3, Q96LJ2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: May 20, 2008
Last modified: June 8, 2016
This is version 100 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.