Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Pleckstrin homology-like domain family B member 1

Gene

Phldb1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Pleckstrin homology-like domain family B member 1
Alternative name(s):
Protein LL5-alpha
Gene namesi
Name:Phldb1
Synonyms:Kiaa0638, Ll5a
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 9

Organism-specific databases

MGIiMGI:2143230. Phldb1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000538921 – 1371Pleckstrin homology-like domain family B member 1Add BLAST1371

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei51PhosphoserineCombined sources1
Modified residuei131Asymmetric dimethylarginineCombined sources1
Modified residuei192PhosphoserineBy similarity1
Modified residuei220PhosphoserineBy similarity1
Modified residuei223PhosphoserineCombined sources1
Modified residuei325PhosphoserineBy similarity1
Modified residuei335PhosphoserineBy similarity1
Modified residuei382PhosphoserineCombined sources1
Modified residuei405PhosphoserineBy similarity1
Modified residuei431PhosphoserineBy similarity1
Modified residuei445PhosphoserineBy similarity1
Modified residuei463PhosphoserineBy similarity1
Modified residuei472PhosphoserineCombined sources1
Modified residuei491PhosphoserineBy similarity1
Modified residuei503PhosphoserineCombined sources1
Modified residuei514Omega-N-methylarginineCombined sources1
Modified residuei520PhosphoserineCombined sources1
Modified residuei522PhosphoserineCombined sources1
Modified residuei524PhosphothreonineCombined sources1
Modified residuei535PhosphoserineCombined sources1
Modified residuei541PhosphoserineCombined sources1
Modified residuei553PhosphoserineCombined sources1
Modified residuei557PhosphoserineCombined sources1
Modified residuei565PhosphoserineBy similarity1
Modified residuei580PhosphoserineCombined sources1
Modified residuei585PhosphoserineCombined sources1
Modified residuei683PhosphoserineBy similarity1
Modified residuei976PhosphoserineBy similarity1
Modified residuei1022PhosphoserineCombined sources1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

PaxDbiQ6PDH0.
PeptideAtlasiQ6PDH0.
PRIDEiQ6PDH0.

PTM databases

iPTMnetiQ6PDH0.
PhosphoSitePlusiQ6PDH0.

Expressioni

Gene expression databases

BgeeiENSMUSG00000048537.
ExpressionAtlasiQ6PDH0. baseline and differential.
GenevisibleiQ6PDH0. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000034611.

Structurei

3D structure databases

ProteinModelPortaliQ6PDH0.
SMRiQ6PDH0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini64 – 125FHAAdd BLAST62
Domaini1261 – 1364PHPROSITE-ProRule annotationAdd BLAST104

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili688 – 798Sequence analysisAdd BLAST111
Coiled coili1150 – 1216Sequence analysisAdd BLAST67

Domaini

The PH domain mediates the binding to phosphoinositides.By similarity

Sequence similaritiesi

Contains 1 FHA domain.Curated
Contains 1 PH domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410ISGZ. Eukaryota.
ENOG41101DY. LUCA.
GeneTreeiENSGT00530000063148.
HOGENOMiHOG000286004.
HOVERGENiHBG080571.
InParanoidiQ6PDH0.
TreeFamiTF329165.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
2.60.200.20. 1 hit.
InterProiIPR000253. FHA_dom.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR008984. SMAD_FHA_domain.
[Graphical view]
PfamiPF00169. PH. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
[Graphical view]
SUPFAMiSSF49879. SSF49879. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6PDH0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDPLNRSQLG PGCKTQAVVQ KGPLDLIETG QGLKVQTDKP HLVSLGSGRL
60 70 80 90 100
STAITLLPLE EGRTVIGSAA RDISLQGPGL APEHCYIENL RGTLTLYPCG
110 120 130 140 150
NACTIDGLPV RQPTRLTQGC MLCLGQSTFL RFNHPAEAKW MKSMIPAGVR
160 170 180 190 200
APGPTYNPGS AESESLVNGN HTAQPATRAP SACASHSSLV SSIEKDLQEI
210 220 230 240 250
MDSLVLEEPG AAGKKPAATS PLSPMANGGR YLLSPPTSPG AMSVGSSYEN
260 270 280 290 300
TSPAFSPLSS PASSGSCASH SPSGQEPGPS VPPLVPARSS SYHLALQPPQ
310 320 330 340 350
SRPSGSRSSD SPRLGRKGGH ERPPSPGLRG LLTDSPAATV LAEARRTTES
360 370 380 390 400
PRLGGQLPVV AISLSEYPSS GARSQPASIP GSPKFQSPVP APRNKIGTLQ
410 420 430 440 450
DRPPSPFREP PGTERVLTSS PSRQLVGRTF SDGLAATRTL QPPESPRLGR
460 470 480 490 500
RGLDSMRELP PLSPSLSRRA LSPLPARTAP DPKLSREVAE SPRPRRWAAH
510 520 530 540 550
GTSPEDFSLT LGARGRRTRS PSPTLGESLA PRKGSFSGRL SPAYSLGSLT
560 570 580 590 600
GASPRQSPRA QRKLSSGDLR VPIPRERKNS ITEISDNEDE LLEYHRRQRQ
610 620 630 640 650
ERLREQEMER LERQRLETIL NLCAEYSRAD GGPETGELPS IGEATAALAL
660 670 680 690 700
AGRRPSRGLA GAIVVSGRCG EESGGASQRL WESMERSDEE NLKEECSSTE
710 720 730 740 750
STQQEHEDAP GAKHQGEVLA VEEERAQVLG RVEQLKIRVK ELEQQLQEAA
760 770 780 790 800
REAEMERALL QGEREAERAS LQKEQRAVDQ LQEKLVALET GIQKDRDKEA
810 820 830 840 850
DALETETKLF EDLEFQQLER ESRVEEEREL AGQGLLRSKA ELLRSVSKRK
860 870 880 890 900
ERLAVLDSQA GQIRAQAVQE SERLAREKNA ALQLLQKEKE KLNVLERRYH
910 920 930 940 950
SLTGGRPFPK TTSTLKEMEK LLLPAVDLEQ WYQELMSGLG TGLAAASPRS
960 970 980 990 1000
SPPPLPAKAS RQLQVYRSKM DSDAASPLPR TRSGPLPSSS GSSSSSSQLS
1010 1020 1030 1040 1050
VATLGRSPSP KSALLAQNGT SSLPRNLAAT LQDIETKRQL ALQQKGHQVI
1060 1070 1080 1090 1100
EEQRRRLAEL KQKAAAEAQC QWDALHGAGP FSAGPSGFPA LMHHSILHHL
1110 1120 1130 1140 1150
PAGRERGEEG EHAYDTLSLE SSDSMETSIS TGGNSACSPD NMSSASGLDM
1160 1170 1180 1190 1200
GKIEEMEKML KEAHAEKSRL MESREREMEL RRQALEEERR RREQVERRLQ
1210 1220 1230 1240 1250
SESARRQQLV EKEVKLREKQ FSQARPLTRY LPNRKEDFDL KTHIESSGHG
1260 1270 1280 1290 1300
VDTCLHVVLS SKVCRGYLIK MGGKIKSWKK RWFVFDRLKR TLSYYVDKHE
1310 1320 1330 1340 1350
TKLKGVIYFQ AIEEVYYDHL RSAAKSPNPA LTFCVKTHDR LYYMVAPSAE
1360 1370
AMRIWMDVIV TGAEGYTQFM N
Length:1,371
Mass (Da):150,070
Last modified:July 5, 2004 - v1
Checksum:iE0E5204FF8C3C8C5
GO
Isoform 2 (identifier: Q6PDH0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     917-917: E → EYVTLEQLRVVWGTPPMPPSPSPGLPSWASASQDLAPITCLPPMLPSSFASITRSSK
     1174-1174: R → RVRLTGARRQQV
     1325-1325: K → KKRFFHFTMVTE

Show »
Length:1,449
Mass (Da):158,694
Checksum:i60C2084D57B499AD
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti402R → H in BAC65618 (PubMed:12693553).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_016741917E → EYVTLEQLRVVWGTPPMPPS PSPGLPSWASASQDLAPITC LPPMLPSSFASITRSSK in isoform 2. 1 Publication1
Alternative sequenceiVSP_0167421174R → RVRLTGARRQQV in isoform 2. 1 Publication1
Alternative sequenceiVSP_0167431325K → KKRFFHFTMVTE in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC058712 mRNA. Translation: AAH58712.1.
AK122336 mRNA. Translation: BAC65618.1.
CCDSiCCDS23118.1. [Q6PDH0-1]
RefSeqiNP_705765.3. NM_153537.4. [Q6PDH0-1]
UniGeneiMm.28639.

Genome annotation databases

EnsembliENSMUST00000034611; ENSMUSP00000034611; ENSMUSG00000048537. [Q6PDH0-1]
GeneIDi102693.
KEGGimmu:102693.
UCSCiuc009peh.2. mouse. [Q6PDH0-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC058712 mRNA. Translation: AAH58712.1.
AK122336 mRNA. Translation: BAC65618.1.
CCDSiCCDS23118.1. [Q6PDH0-1]
RefSeqiNP_705765.3. NM_153537.4. [Q6PDH0-1]
UniGeneiMm.28639.

3D structure databases

ProteinModelPortaliQ6PDH0.
SMRiQ6PDH0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000034611.

PTM databases

iPTMnetiQ6PDH0.
PhosphoSitePlusiQ6PDH0.

Proteomic databases

PaxDbiQ6PDH0.
PeptideAtlasiQ6PDH0.
PRIDEiQ6PDH0.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000034611; ENSMUSP00000034611; ENSMUSG00000048537. [Q6PDH0-1]
GeneIDi102693.
KEGGimmu:102693.
UCSCiuc009peh.2. mouse. [Q6PDH0-1]

Organism-specific databases

CTDi23187.
MGIiMGI:2143230. Phldb1.
RougeiSearch...

Phylogenomic databases

eggNOGiENOG410ISGZ. Eukaryota.
ENOG41101DY. LUCA.
GeneTreeiENSGT00530000063148.
HOGENOMiHOG000286004.
HOVERGENiHBG080571.
InParanoidiQ6PDH0.
TreeFamiTF329165.

Miscellaneous databases

ChiTaRSiPhldb1. mouse.
PROiQ6PDH0.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000048537.
ExpressionAtlasiQ6PDH0. baseline and differential.
GenevisibleiQ6PDH0. MM.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
2.60.200.20. 1 hit.
InterProiIPR000253. FHA_dom.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR008984. SMAD_FHA_domain.
[Graphical view]
PfamiPF00169. PH. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
[Graphical view]
SUPFAMiSSF49879. SSF49879. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPHLB1_MOUSE
AccessioniPrimary (citable) accession number: Q6PDH0
Secondary accession number(s): Q80TV2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 20, 2005
Last sequence update: July 5, 2004
Last modified: November 2, 2016
This is version 100 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.