Q6PDH0 (PHLB1_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 72.
History...
Clusters with 
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Pleckstrin homology-like domain family B member 1 Alternative name(s): Protein LL5-alpha | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus |
Protein attributes
| Sequence length | 1371 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Domain | The PH domain mediates the binding to phosphoinositides By similarity. |
| Sequence similarities | Contains 1 FHA domain. Contains 1 PH domain. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Molecular_function | phospholipid binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6PDH0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6PDH0-2) The sequence of this isoform differs from the canonical sequence as follows: 917-917: E → EYVTLEQLRVVWGTPPMPPSPSPGLPSWASASQDLAPITCLPPMLPSSFASITRSSK 1174-1174: R → RVRLTGARRQQV 1325-1325: K → KKRFFHFTMVTE |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1371 | 1371 | Pleckstrin homology-like domain family B member 1 | PRO_0000053892 | |||||
Regions | |||||||||
| Domain | 64 – 125 | 62 | FHA | ||||||
| Domain | 1261 – 1364 | 104 | PH | ||||||
| Coiled coil | 688 – 798 | 111 | Potential | ||||||
| Coiled coil | 1150 – 1216 | 67 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 220 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 223 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 325 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 431 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 445 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 503 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 520 | 1 | Phosphoserine Ref.4 | ||||||
| Modified residue | 522 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 524 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 553 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 557 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 565 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 585 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 917 | 1 | E → EYVTLEQLRVVWGTPPMPPS PSPGLPSWASASQDLAPITC LPPMLPSSFASITRSSK in isoform 2. | VSP_016741 | |||||
| Alternative sequence | 1174 | 1 | R → RVRLTGARRQQV in isoform 2. | VSP_016742 | |||||
| Alternative sequence | 1325 | 1 | K → KKRFFHFTMVTE in isoform 2. | VSP_016743 | |||||
Experimental info | |||||||||
| Sequence conflict | 402 | 1 | R → H in BAC65618. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: C57BL/6. Tissue: Brain. |
| [2] | "Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries." Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H. DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 64-1371 (ISOFORM 2). Tissue: Brain. |
| [3] | "Identification and characterization of human LL5A gene and mouse Ll5a gene in silico." Katoh M., Katoh M. Int. J. Oncol. 23:1477-1483(2003) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION OF THE GENE. |
| [4] | "Large-scale phosphorylation analysis of mouse liver." Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-520, MASS SPECTROMETRY. Tissue: Liver. |
| [5] | "Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry." Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J., Faessler R., Mann M. J. Proteome Res. 7:5314-5326(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-565, MASS SPECTROMETRY. Tissue: Melanoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | BC058712 mRNA. Translation: AAH58712.1. AK122336 mRNA. Translation: BAC65618.1. |
| IPI | IPI00330246. IPI00468120. |
| RefSeq | NP_705765.3. NM_153537.4. |
| UniGene | Mm.28639. |
3D structure databases | |
| ProteinModelPortal | Q6PDH0. |
| SMR | Q6PDH0. Positions 40-139, 1266-1359. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q6PDH0. |
Proteomic databases | |
| PaxDb | Q6PDH0. |
| PRIDE | Q6PDH0. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000034611; ENSMUSP00000034611; ENSMUSG00000048537. |
| GeneID | 102693. |
| KEGG | mmu:102693. |
| UCSC | uc009peh.1. mouse. |
Organism-specific databases | |
| CTD | 23187. |
| MGI | MGI:2143230. Phldb1. |
| Rouge | Search... |
Phylogenomic databases | |
| eggNOG | NOG86245. |
| GeneTree | ENSGT00530000063148. |
| HOGENOM | HOG000286004. |
| HOVERGEN | HBG080571. |
| OrthoDB | EOG4M0F15. |
Gene expression databases | |
| ArrayExpress | Q6PDH0. |
| Bgee | Q6PDH0. |
| Genevestigator | Q6PDH0. |
| GermOnline | ENSMUSG00000048537. Mus musculus. |
Family and domain databases | |
| Gene3D | 2.30.29.30. 1 hit. 2.60.200.20. 1 hit. |
| InterPro | IPR000253. FHA_dom. IPR011993. PH_like_dom. IPR001849. Pleckstrin_homology. IPR008984. SMAD_FHA_domain. [Graphical view] |
| Pfam | PF00169. PH. 1 hit. [Graphical view] |
| SMART | SM00233. PH. 1 hit. [Graphical view] |
| SUPFAM | SSF49879. SMAD_FHA. 1 hit. |
| PROSITE | PS50006. FHA_DOMAIN. False negative. PS50003. PH_DOMAIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 355627. |
| SOURCE | Search... |
Entry information
| Entry name | PHLB1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q6PDH0 Secondary accession number(s): Q80TV2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |