Q6PCP5 (MFF_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 64.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Mitochondrial fission factor | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 291 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Plays a role in mitochondrial and peroxisomal fission By similarity. |
| Subcellular location | Mitochondrion outer membrane; Single-pass type IV membrane protein By similarity. |
| Sequence similarities | Belongs to the tango11 family. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6PCP5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6PCP5-2) The sequence of this isoform differs from the canonical sequence as follows: 117-117: E → EQ 148-200: Missing. | ||||||
| Isoform 3 (identifier: Q6PCP5-3) The sequence of this isoform differs from the canonical sequence as follows: 148-200: Missing. | ||||||
| Isoform 4 (identifier: Q6PCP5-4) The sequence of this isoform differs from the canonical sequence as follows: 147-220: IVTPSPPQARVCPPHMLPEDGANLSSARGILSLIQSSTRRAYQQILDVLDENRRPVLRGGSAAATSNPHHDNVR → M |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 291 | 291 | Mitochondrial fission factor | PRO_0000289185 | |||||
Regions | |||||||||
| Topological domain | 1 – 271 | 271 | Cytoplasmic Potential | ||||||
| Transmembrane | 272 – 289 | 18 | Helical; Anchor for type IV membrane protein; Potential | ||||||
| Topological domain | 290 – 291 | 2 | Mitochondrial intermembrane Potential | ||||||
| Coiled coil | 240 – 271 | 32 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 89 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 129 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 131 | 1 | Phosphoserine Ref.4 Ref.5 | ||||||
| Modified residue | 146 | 1 | Phosphoserine Ref.3 | ||||||
| Modified residue | 149 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 151 | 1 | Phosphoserine Ref.3 | ||||||
| Modified residue | 178 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 182 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 117 | 1 | E → EQ in isoform 2. | VSP_025959 | |||||
| Alternative sequence | 147 – 220 | 74 | IVTPS…HDNVR → M in isoform 4. | VSP_025960 | |||||
| Alternative sequence | 148 – 200 | 53 | Missing in isoform 2 and isoform 3. | VSP_025961 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| [1] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). Strain: C57BL/6J. Tissue: Egg and Xiphoid cartilage. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4). Strain: C57BL/6 and FVB/N. Tissue: Brain and Mammary tumor. |
| [3] | "Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations." Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M. Mol. Cell. Proteomics 6:283-293(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-146 AND SER-151, MASS SPECTROMETRY. Tissue: Brain cortex. |
| [4] | "Mitochondrial phosphoproteome revealed by an improved IMAC method and MS/MS/MS." Lee J., Xu Y., Chen Y., Sprung R., Kim S.C., Xie S., Zhao Y. Mol. Cell. Proteomics 6:669-676(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-131, MASS SPECTROMETRY. Tissue: Liver. |
| [5] | "Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry." Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J., Faessler R., Mann M. J. Proteome Res. 7:5314-5326(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-129 AND SER-131, MASS SPECTROMETRY. Tissue: Melanoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK017226 mRNA. Translation: BAB30643.1. AK139649 mRNA. Translation: BAE24093.1. BC016597 mRNA. Translation: AAH16597.1. BC059229 mRNA. Translation: AAH59229.1. |
| IPI | IPI00126855. IPI00420734. IPI00467571. IPI00850543. |
| RefSeq | NP_083685.2. NM_029409.2. |
| UniGene | Mm.396863. |
3D structure databases | |
| ProteinModelPortal | Q6PCP5. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q6PCP5. |
Proteomic databases | |
| PaxDb | Q6PCP5. |
| PRIDE | Q6PCP5. |
Protocols and materials databases | |
| DNASU | 75734. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000073025; ENSMUSP00000072784; ENSMUSG00000026150. ENSMUST00000078332; ENSMUSP00000077446; ENSMUSG00000026150. ENSMUST00000160786; ENSMUSP00000125230; ENSMUSG00000026150. ENSMUST00000160972; ENSMUSP00000124200; ENSMUSG00000026150. |
| GeneID | 75734. |
| KEGG | mmu:75734. |
| UCSC | uc007brx.1. mouse. uc007bry.1. mouse. uc007brz.1. mouse. uc007bsb.1. mouse. |
Organism-specific databases | |
| CTD | 56947. |
| MGI | MGI:1922984. Mff. |
Phylogenomic databases | |
| eggNOG | NOG43415. |
| GeneTree | ENSGT00390000009776. |
| HOGENOM | HOG000285976. |
| HOVERGEN | HBG105704. |
| InParanoid | Q6PCP5. |
| OrthoDB | EOG441QBV. |
Gene expression databases | |
| ArrayExpress | Q6PCP5. |
| Bgee | Q6PCP5. |
| Genevestigator | Q6PCP5. |
Family and domain databases | |
| InterPro | IPR008518. FATE/Miff/Tango-11. [Graphical view] |
| PANTHER | PTHR16501. PTHR16501. 1 hit. |
| Pfam | PF05644. Miff. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | MFF. mouse. |
| NextBio | 343810. |
| SOURCE | Search... |
Entry information
| Entry name | MFF_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q6PCP5 Secondary accession number(s): Q3UT87, Q91VG0, Q9D3P5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
