Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6PCP5

- MFF_MOUSE

UniProt

Q6PCP5 - MFF_MOUSE

Protein

Mitochondrial fission factor

Gene

Mff

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 76 (01 Oct 2014)
      Sequence version 1 (05 Jul 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Plays a role in mitochondrial and peroxisomal fission. Promotes the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface. May be involved in regulation of synaptic vesicle membrane dynamics by recruitment of DNM1L to clathrin-containing vesicles.1 Publication

    GO - Molecular functioni

    1. protein binding Source: MGI
    2. protein homodimerization activity Source: UniProtKB

    GO - Biological processi

    1. mitochondrial fission Source: UniProtKB
    2. mitochondrial fragmentation involved in apoptotic process Source: Ensembl
    3. mitochondrial fusion Source: UniProtKB
    4. mitochondrion morphogenesis Source: Ensembl
    5. peroxisome fission Source: Ensembl
    6. positive regulation of mitochondrial fission Source: UniProtKB
    7. positive regulation of protein targeting to membrane Source: UniProtKB
    8. positive regulation of release of cytochrome c from mitochondria Source: Ensembl
    9. protein homooligomerization Source: Ensembl
    10. protein targeting to mitochondrion Source: Ensembl
    11. regulation of peroxisome organization Source: Ensembl
    12. release of cytochrome c from mitochondria Source: Ensembl

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Mitochondrial fission factor
    Gene namesi
    Name:Mff
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 1

    Organism-specific databases

    MGIiMGI:1922984. Mff.

    Subcellular locationi

    GO - Cellular componenti

    1. cell junction Source: UniProtKB-KW
    2. integral component of mitochondrial membrane Source: Ensembl
    3. mitochondrial outer membrane Source: MGI
    4. mitochondrion Source: UniProtKB
    5. peroxisome Source: UniProtKB
    6. synaptic vesicle Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell junction, Cytoplasmic vesicle, Membrane, Mitochondrion, Mitochondrion outer membrane, Peroxisome, Synapse

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 291291Mitochondrial fission factorPRO_0000289185Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei89 – 891PhosphothreonineBy similarity
    Modified residuei129 – 1291PhosphoserineBy similarity
    Modified residuei131 – 1311PhosphoserineBy similarity
    Modified residuei146 – 1461Phosphoserine1 Publication
    Modified residuei149 – 1491PhosphothreonineBy similarity
    Modified residuei151 – 1511PhosphoserineBy similarity
    Modified residuei178 – 1781PhosphoserineBy similarity
    Modified residuei182 – 1821PhosphoserineBy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ6PCP5.
    PaxDbiQ6PCP5.
    PRIDEiQ6PCP5.

    PTM databases

    PhosphoSiteiQ6PCP5.

    Expressioni

    Gene expression databases

    BgeeiQ6PCP5.
    GenevestigatoriQ6PCP5.

    Interactioni

    Subunit structurei

    Homodimer. Interacts with DNM1L By similarity.By similarity

    Structurei

    3D structure databases

    ProteinModelPortaliQ6PCP5.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 271271CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini290 – 2912Mitochondrial intermembraneSequence Analysis

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei272 – 28918Helical; Anchor for type IV membrane proteinSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili240 – 27132Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Belongs to the Tango11 family.Curated

    Keywords - Domaini

    Coiled coil, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG43415.
    GeneTreeiENSGT00390000009776.
    HOGENOMiHOG000285976.
    HOVERGENiHBG105704.
    InParanoidiQ6PCP5.
    OrthoDBiEOG7FV3QK.
    PhylomeDBiQ6PCP5.
    TreeFamiTF325506.

    Family and domain databases

    InterProiIPR008518. FATE/Miff/Tango-11.
    [Graphical view]
    PANTHERiPTHR16501. PTHR16501. 1 hit.
    PfamiPF05644. Miff. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6PCP5-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAEISRIQYE MEYTEGISQR MRVPEKLKVA PPNADLEQEF QDGVPNASVI    50
    MQVPERIVVT GNNEDISFSR PADLDLIQST PFKPLALKTP PRVLTLSERP 100
    LDFLDLERPL PTPQSEESRA VGRLKRERSM SENAVRQNGQ LVRNDSIVTP 150
    SPPQARVCPP HMLPEDGANL SSARGILSLI QSSTRRAYQQ ILDVLDENRR 200
    PVLRGGSAAA TSNPHHDNVR YGISNLDAAI EGASDDMTVV DAASLRRQII 250
    KLNRRLQLLE EENKERAKRE MVMYSITVAF WLLNSWLWFR R 291
    Length:291
    Mass (Da):32,931
    Last modified:July 5, 2004 - v1
    Checksum:i658884A1EF8EBCFD
    GO
    Isoform 2 (identifier: Q6PCP5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         117-117: E → EQ
         148-200: Missing.

    Show »
    Length:239
    Mass (Da):27,222
    Checksum:i2B5C47D0D90A5EEF
    GO
    Isoform 3 (identifier: Q6PCP5-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         148-200: Missing.

    Show »
    Length:238
    Mass (Da):27,094
    Checksum:i73E5E0480871D0AB
    GO
    Isoform 4 (identifier: Q6PCP5-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         147-220: IVTPSPPQARVCPPHMLPEDGANLSSARGILSLIQSSTRRAYQQILDVLDENRRPVLRGGSAAATSNPHHDNVR → M

    Show »
    Length:218
    Mass (Da):25,074
    Checksum:iC9E438153B01BC0C
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei117 – 1171E → EQ in isoform 2. 1 PublicationVSP_025959
    Alternative sequencei147 – 22074IVTPS…HDNVR → M in isoform 4. 1 PublicationVSP_025960Add
    BLAST
    Alternative sequencei148 – 20053Missing in isoform 2 and isoform 3. 1 PublicationVSP_025961Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK017226 mRNA. Translation: BAB30643.1.
    AK139649 mRNA. Translation: BAE24093.1.
    BC016597 mRNA. Translation: AAH16597.1.
    BC059229 mRNA. Translation: AAH59229.1.
    CCDSiCCDS15098.1. [Q6PCP5-1]
    RefSeqiNP_083685.2. NM_029409.2. [Q6PCP5-1]
    XP_006496633.1. XM_006496570.1. [Q6PCP5-2]
    XP_006496634.1. XM_006496571.1. [Q6PCP5-3]
    XP_006496636.1. XM_006496573.1. [Q6PCP5-4]
    UniGeneiMm.396863.

    Genome annotation databases

    EnsembliENSMUST00000073025; ENSMUSP00000072784; ENSMUSG00000026150. [Q6PCP5-2]
    ENSMUST00000078332; ENSMUSP00000077446; ENSMUSG00000026150. [Q6PCP5-1]
    ENSMUST00000160786; ENSMUSP00000125230; ENSMUSG00000026150. [Q6PCP5-3]
    ENSMUST00000160972; ENSMUSP00000124200; ENSMUSG00000026150. [Q6PCP5-4]
    GeneIDi75734.
    KEGGimmu:75734.
    UCSCiuc007brx.1. mouse. [Q6PCP5-1]
    uc007bry.1. mouse. [Q6PCP5-3]
    uc007brz.1. mouse. [Q6PCP5-2]
    uc007bsc.1. mouse. [Q6PCP5-4]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK017226 mRNA. Translation: BAB30643.1 .
    AK139649 mRNA. Translation: BAE24093.1 .
    BC016597 mRNA. Translation: AAH16597.1 .
    BC059229 mRNA. Translation: AAH59229.1 .
    CCDSi CCDS15098.1. [Q6PCP5-1 ]
    RefSeqi NP_083685.2. NM_029409.2. [Q6PCP5-1 ]
    XP_006496633.1. XM_006496570.1. [Q6PCP5-2 ]
    XP_006496634.1. XM_006496571.1. [Q6PCP5-3 ]
    XP_006496636.1. XM_006496573.1. [Q6PCP5-4 ]
    UniGenei Mm.396863.

    3D structure databases

    ProteinModelPortali Q6PCP5.
    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei Q6PCP5.

    Proteomic databases

    MaxQBi Q6PCP5.
    PaxDbi Q6PCP5.
    PRIDEi Q6PCP5.

    Protocols and materials databases

    DNASUi 75734.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000073025 ; ENSMUSP00000072784 ; ENSMUSG00000026150 . [Q6PCP5-2 ]
    ENSMUST00000078332 ; ENSMUSP00000077446 ; ENSMUSG00000026150 . [Q6PCP5-1 ]
    ENSMUST00000160786 ; ENSMUSP00000125230 ; ENSMUSG00000026150 . [Q6PCP5-3 ]
    ENSMUST00000160972 ; ENSMUSP00000124200 ; ENSMUSG00000026150 . [Q6PCP5-4 ]
    GeneIDi 75734.
    KEGGi mmu:75734.
    UCSCi uc007brx.1. mouse. [Q6PCP5-1 ]
    uc007bry.1. mouse. [Q6PCP5-3 ]
    uc007brz.1. mouse. [Q6PCP5-2 ]
    uc007bsc.1. mouse. [Q6PCP5-4 ]

    Organism-specific databases

    CTDi 56947.
    MGIi MGI:1922984. Mff.

    Phylogenomic databases

    eggNOGi NOG43415.
    GeneTreei ENSGT00390000009776.
    HOGENOMi HOG000285976.
    HOVERGENi HBG105704.
    InParanoidi Q6PCP5.
    OrthoDBi EOG7FV3QK.
    PhylomeDBi Q6PCP5.
    TreeFami TF325506.

    Miscellaneous databases

    ChiTaRSi MFF. mouse.
    NextBioi 343810.
    PROi Q6PCP5.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q6PCP5.
    Genevestigatori Q6PCP5.

    Family and domain databases

    InterProi IPR008518. FATE/Miff/Tango-11.
    [Graphical view ]
    PANTHERi PTHR16501. PTHR16501. 1 hit.
    Pfami PF05644. Miff. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
      Strain: C57BL/6J.
      Tissue: Egg and Xiphoid cartilage.
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4).
      Strain: C57BL/6 and FVB/N.
      Tissue: Brain and Mammary tumor.
    3. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-146, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Liver.
    4. "Fis1, Mff, MiD49, and MiD51 mediate Drp1 recruitment in mitochondrial fission."
      Loson O.C., Song Z., Chen H., Chan D.C.
      Mol. Biol. Cell 24:659-667(2013) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.

    Entry informationi

    Entry nameiMFF_MOUSE
    AccessioniPrimary (citable) accession number: Q6PCP5
    Secondary accession number(s): Q3UT87, Q91VG0, Q9D3P5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 29, 2007
    Last sequence update: July 5, 2004
    Last modified: October 1, 2014
    This is version 76 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3