Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q6PCP5 (MFF_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 72. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Mitochondrial fission factor
Gene names
Name:Mff
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length291 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Plays a role in mitochondrial and peroxisomal fission. Promotes the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface. May be involved in regulation of synaptic vesicle membrane dynamics by recruitment of DNM1L to clathrin-containing vesicles. Ref.4

Subunit structure

Homodimer. Interacts with DNM1L By similarity.

Subcellular location

Mitochondrion outer membrane; Single-pass type IV membrane protein By similarity. Peroxisome By similarity. Cytoplasmic vesiclesecretory vesiclesynaptic vesicle By similarity.

Sequence similarities

Belongs to the Tango11 family.

Ontologies

Keywords
   Cellular componentCell junction
Cytoplasmic vesicle
Membrane
Mitochondrion
Mitochondrion outer membrane
Peroxisome
Synapse
   Coding sequence diversityAlternative splicing
   DomainCoiled coil
Transmembrane
Transmembrane helix
   PTMPhosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processmitochondrial fission

Inferred from mutant phenotype Ref.4. Source: UniProtKB

mitochondrial fragmentation involved in apoptotic process

Inferred from electronic annotation. Source: Ensembl

mitochondrial fusion

Inferred from sequence or structural similarity. Source: UniProtKB

mitochondrion morphogenesis

Inferred from electronic annotation. Source: Ensembl

peroxisome fission

Inferred from electronic annotation. Source: Ensembl

positive regulation of mitochondrial fission

Inferred from sequence or structural similarity. Source: UniProtKB

positive regulation of protein targeting to membrane

Inferred from sequence or structural similarity. Source: UniProtKB

positive regulation of release of cytochrome c from mitochondria

Inferred from electronic annotation. Source: Ensembl

protein homooligomerization

Inferred from electronic annotation. Source: Ensembl

protein targeting to mitochondrion

Inferred from electronic annotation. Source: Ensembl

regulation of peroxisome organization

Inferred from electronic annotation. Source: Ensembl

release of cytochrome c from mitochondria

Inferred from electronic annotation. Source: Ensembl

   Cellular_componentcell junction

Inferred from electronic annotation. Source: UniProtKB-KW

integral component of mitochondrial membrane

Inferred from electronic annotation. Source: Ensembl

mitochondrial outer membrane

Inferred from direct assay PubMed 21149567. Source: MGI

mitochondrion

Inferred from direct assay PubMed 20451243. Source: UniProtKB

peroxisome

Inferred from direct assay PubMed 20451243. Source: UniProtKB

synaptic vesicle

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionprotein homodimerization activity

Inferred from sequence or structural similarity. Source: UniProtKB

Complete GO annotation...

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q6PCP5-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q6PCP5-2)

The sequence of this isoform differs from the canonical sequence as follows:
     117-117: E → EQ
     148-200: Missing.
Isoform 3 (identifier: Q6PCP5-3)

The sequence of this isoform differs from the canonical sequence as follows:
     148-200: Missing.
Isoform 4 (identifier: Q6PCP5-4)

The sequence of this isoform differs from the canonical sequence as follows:
     147-220: IVTPSPPQARVCPPHMLPEDGANLSSARGILSLIQSSTRRAYQQILDVLDENRRPVLRGGSAAATSNPHHDNVR → M

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 291291Mitochondrial fission factor
PRO_0000289185

Regions

Topological domain1 – 271271Cytoplasmic Potential
Transmembrane272 – 28918Helical; Anchor for type IV membrane protein; Potential
Topological domain290 – 2912Mitochondrial intermembrane Potential
Coiled coil240 – 27132 Potential

Amino acid modifications

Modified residue891Phosphothreonine By similarity
Modified residue1291Phosphoserine By similarity
Modified residue1311Phosphoserine By similarity
Modified residue1461Phosphoserine Ref.3
Modified residue1491Phosphothreonine By similarity
Modified residue1511Phosphoserine By similarity
Modified residue1781Phosphoserine By similarity
Modified residue1821Phosphoserine By similarity

Natural variations

Alternative sequence1171E → EQ in isoform 2.
VSP_025959
Alternative sequence147 – 22074IVTPS…HDNVR → M in isoform 4.
VSP_025960
Alternative sequence148 – 20053Missing in isoform 2 and isoform 3.
VSP_025961

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 5, 2004. Version 1.
Checksum: 658884A1EF8EBCFD

FASTA29132,931
        10         20         30         40         50         60 
MAEISRIQYE MEYTEGISQR MRVPEKLKVA PPNADLEQEF QDGVPNASVI MQVPERIVVT 

        70         80         90        100        110        120 
GNNEDISFSR PADLDLIQST PFKPLALKTP PRVLTLSERP LDFLDLERPL PTPQSEESRA 

       130        140        150        160        170        180 
VGRLKRERSM SENAVRQNGQ LVRNDSIVTP SPPQARVCPP HMLPEDGANL SSARGILSLI 

       190        200        210        220        230        240 
QSSTRRAYQQ ILDVLDENRR PVLRGGSAAA TSNPHHDNVR YGISNLDAAI EGASDDMTVV 

       250        260        270        280        290 
DAASLRRQII KLNRRLQLLE EENKERAKRE MVMYSITVAF WLLNSWLWFR R 

« Hide

Isoform 2 [UniParc].

Checksum: 2B5C47D0D90A5EEF
Show »

FASTA23927,222
Isoform 3 [UniParc].

Checksum: 73E5E0480871D0AB
Show »

FASTA23827,094
Isoform 4 [UniParc].

Checksum: C9E438153B01BC0C
Show »

FASTA21825,074

References

« Hide 'large scale' references
[1]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
Strain: C57BL/6J.
Tissue: Egg and Xiphoid cartilage.
[2]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4).
Strain: C57BL/6 and FVB/N.
Tissue: Brain and Mammary tumor.
[3]"Large-scale phosphorylation analysis of mouse liver."
Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-146, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Liver.
[4]"Fis1, Mff, MiD49, and MiD51 mediate Drp1 recruitment in mitochondrial fission."
Loson O.C., Song Z., Chen H., Chan D.C.
Mol. Biol. Cell 24:659-667(2013) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK017226 mRNA. Translation: BAB30643.1.
AK139649 mRNA. Translation: BAE24093.1.
BC016597 mRNA. Translation: AAH16597.1.
BC059229 mRNA. Translation: AAH59229.1.
RefSeqNP_083685.2. NM_029409.2.
XP_006496633.1. XM_006496570.1.
XP_006496634.1. XM_006496571.1.
XP_006496636.1. XM_006496573.1.
UniGeneMm.396863.

3D structure databases

ProteinModelPortalQ6PCP5.
ModBaseSearch...
MobiDBSearch...

PTM databases

PhosphoSiteQ6PCP5.

Proteomic databases

PaxDbQ6PCP5.
PRIDEQ6PCP5.

Protocols and materials databases

DNASU75734.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000073025; ENSMUSP00000072784; ENSMUSG00000026150. [Q6PCP5-2]
ENSMUST00000078332; ENSMUSP00000077446; ENSMUSG00000026150. [Q6PCP5-1]
ENSMUST00000160786; ENSMUSP00000125230; ENSMUSG00000026150. [Q6PCP5-3]
ENSMUST00000160972; ENSMUSP00000124200; ENSMUSG00000026150. [Q6PCP5-4]
GeneID75734.
KEGGmmu:75734.
UCSCuc007brx.1. mouse. [Q6PCP5-1]
uc007bry.1. mouse. [Q6PCP5-3]
uc007brz.1. mouse. [Q6PCP5-2]
uc007bsc.1. mouse. [Q6PCP5-4]

Organism-specific databases

CTD56947.
MGIMGI:1922984. Mff.

Phylogenomic databases

eggNOGNOG43415.
GeneTreeENSGT00390000009776.
HOGENOMHOG000285976.
HOVERGENHBG105704.
InParanoidQ6PCP5.
OrthoDBEOG7FV3QK.
PhylomeDBQ6PCP5.
TreeFamTF325506.

Gene expression databases

BgeeQ6PCP5.
GenevestigatorQ6PCP5.

Family and domain databases

InterProIPR008518. FATE/Miff/Tango-11.
[Graphical view]
PANTHERPTHR16501. PTHR16501. 1 hit.
PfamPF05644. Miff. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSMFF. mouse.
NextBio343810.
PROQ6PCP5.
SOURCESearch...

Entry information

Entry nameMFF_MOUSE
AccessionPrimary (citable) accession number: Q6PCP5
Secondary accession number(s): Q3UT87, Q91VG0, Q9D3P5
Entry history
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: July 5, 2004
Last modified: April 16, 2014
This is version 72 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot