Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mitochondrial fission factor

Gene

Mff

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Plays a role in mitochondrial and peroxisomal fission. Promotes the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface. May be involved in regulation of synaptic vesicle membrane dynamics by recruitment of DNM1L to clathrin-containing vesicles.1 Publication

GO - Molecular functioni

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
Mitochondrial fission factor
Gene namesi
Name:Mff
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 1

Organism-specific databases

MGIiMGI:1922984 Mff

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 271CytoplasmicSequence analysisAdd BLAST271
Transmembranei272 – 289Helical; Anchor for type IV membrane proteinSequence analysisAdd BLAST18
Topological domaini290 – 291Mitochondrial intermembraneSequence analysis2

Keywords - Cellular componenti

Cell junction, Cytoplasmic vesicle, Membrane, Mitochondrion, Mitochondrion outer membrane, Peroxisome, Synapse

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002891851 – 291Mitochondrial fission factorAdd BLAST291

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei89PhosphothreonineCombined sources1
Modified residuei129PhosphoserineBy similarity1
Modified residuei131PhosphoserineCombined sources1
Modified residuei146PhosphoserineCombined sources1
Modified residuei149PhosphothreonineCombined sources1
Modified residuei151PhosphoserineCombined sources1
Modified residuei178PhosphoserineBy similarity1
Modified residuei182PhosphoserineBy similarity1
Modified residuei244PhosphoserineCombined sources1
Isoform 4 (identifier: Q6PCP5-4)
Modified residuei146PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ6PCP5
PeptideAtlasiQ6PCP5
PRIDEiQ6PCP5

PTM databases

iPTMnetiQ6PCP5
PhosphoSitePlusiQ6PCP5

Expressioni

Gene expression databases

BgeeiENSMUSG00000026150
ExpressionAtlasiQ6PCP5 baseline and differential
GenevisibleiQ6PCP5 MM

Interactioni

Subunit structurei

Homodimer. Interacts with DNM1L (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

CORUMiQ6PCP5
STRINGi10090.ENSMUSP00000077446

Structurei

3D structure databases

ProteinModelPortaliQ6PCP5
SMRiQ6PCP5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili240 – 271Sequence analysisAdd BLAST32

Sequence similaritiesi

Belongs to the Tango11 family.Curated

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410III7 Eukaryota
ENOG410XSQR LUCA
GeneTreeiENSGT00390000009776
HOGENOMiHOG000285976
HOVERGENiHBG105704
InParanoidiQ6PCP5
KOiK22076
PhylomeDBiQ6PCP5
TreeFamiTF325506

Family and domain databases

InterProiView protein in InterPro
IPR008518 FATE/Miff/Tango-11
PANTHERiPTHR16501 PTHR16501, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6PCP5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEISRIQYE MEYTEGISQR MRVPEKLKVA PPNADLEQEF QDGVPNASVI
60 70 80 90 100
MQVPERIVVT GNNEDISFSR PADLDLIQST PFKPLALKTP PRVLTLSERP
110 120 130 140 150
LDFLDLERPL PTPQSEESRA VGRLKRERSM SENAVRQNGQ LVRNDSIVTP
160 170 180 190 200
SPPQARVCPP HMLPEDGANL SSARGILSLI QSSTRRAYQQ ILDVLDENRR
210 220 230 240 250
PVLRGGSAAA TSNPHHDNVR YGISNLDAAI EGASDDMTVV DAASLRRQII
260 270 280 290
KLNRRLQLLE EENKERAKRE MVMYSITVAF WLLNSWLWFR R
Length:291
Mass (Da):32,931
Last modified:July 5, 2004 - v1
Checksum:i658884A1EF8EBCFD
GO
Isoform 2 (identifier: Q6PCP5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     117-117: E → EQ
     148-200: Missing.

Show »
Length:239
Mass (Da):27,222
Checksum:i2B5C47D0D90A5EEF
GO
Isoform 3 (identifier: Q6PCP5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     148-200: Missing.

Show »
Length:238
Mass (Da):27,094
Checksum:i73E5E0480871D0AB
GO
Isoform 4 (identifier: Q6PCP5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     147-220: IVTPSPPQARVCPPHMLPEDGANLSSARGILSLIQSSTRRAYQQILDVLDENRRPVLRGGSAAATSNPHHDNVR → M

Show »
Length:218
Mass (Da):25,074
Checksum:iC9E438153B01BC0C
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_025959117E → EQ in isoform 2. 1 Publication1
Alternative sequenceiVSP_025960147 – 220IVTPS…HDNVR → M in isoform 4. 1 PublicationAdd BLAST74
Alternative sequenceiVSP_025961148 – 200Missing in isoform 2 and isoform 3. 1 PublicationAdd BLAST53

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK017226 mRNA Translation: BAB30643.1
AK139649 mRNA Translation: BAE24093.1
BC016597 mRNA Translation: AAH16597.1
BC059229 mRNA Translation: AAH59229.1
CCDSiCCDS15098.1 [Q6PCP5-1]
CCDS78630.1 [Q6PCP5-2]
CCDS78631.1 [Q6PCP5-3]
CCDS78632.1 [Q6PCP5-4]
RefSeqiNP_001297624.1, NM_001310695.1 [Q6PCP5-2]
NP_001297626.1, NM_001310697.1 [Q6PCP5-3]
NP_001297628.1, NM_001310699.1 [Q6PCP5-4]
NP_083685.2, NM_029409.3 [Q6PCP5-1]
UniGeneiMm.396863

Genome annotation databases

EnsembliENSMUST00000073025; ENSMUSP00000072784; ENSMUSG00000026150 [Q6PCP5-2]
ENSMUST00000078332; ENSMUSP00000077446; ENSMUSG00000026150 [Q6PCP5-1]
ENSMUST00000160786; ENSMUSP00000125230; ENSMUSG00000026150 [Q6PCP5-3]
ENSMUST00000160972; ENSMUSP00000124200; ENSMUSG00000026150 [Q6PCP5-4]
GeneIDi75734
KEGGimmu:75734
UCSCiuc007brx.1 mouse [Q6PCP5-1]
uc007bry.1 mouse [Q6PCP5-3]
uc007brz.1 mouse [Q6PCP5-2]
uc007bsc.1 mouse [Q6PCP5-4]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiMFF_MOUSE
AccessioniPrimary (citable) accession number: Q6PCP5
Secondary accession number(s): Q3UT87, Q91VG0, Q9D3P5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: July 5, 2004
Last modified: March 28, 2018
This is version 97 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health