SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6PCP5

- MFF_MOUSE

UniProt

Q6PCP5 - MFF_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Mitochondrial fission factor
Gene
Mff
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Plays a role in mitochondrial and peroxisomal fission. Promotes the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface. May be involved in regulation of synaptic vesicle membrane dynamics by recruitment of DNM1L to clathrin-containing vesicles.1 Publication

GO - Molecular functioni

  1. protein binding Source: MGI
  2. protein homodimerization activity Source: UniProtKB
Complete GO annotation...

GO - Biological processi

  1. mitochondrial fission Source: UniProtKB
  2. mitochondrial fragmentation involved in apoptotic process Source: Ensembl
  3. mitochondrial fusion Source: UniProtKB
  4. mitochondrion morphogenesis Source: Ensembl
  5. peroxisome fission Source: Ensembl
  6. positive regulation of mitochondrial fission Source: UniProtKB
  7. positive regulation of protein targeting to membrane Source: UniProtKB
  8. positive regulation of release of cytochrome c from mitochondria Source: Ensembl
  9. protein homooligomerization Source: Ensembl
  10. protein targeting to mitochondrion Source: Ensembl
  11. regulation of peroxisome organization Source: Ensembl
  12. release of cytochrome c from mitochondria Source: Ensembl
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Mitochondrial fission factor
Gene namesi
Name:Mff
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 1

Organism-specific databases

MGIiMGI:1922984. Mff.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 271271Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei272 – 28918Helical; Anchor for type IV membrane protein; Reviewed prediction
Add
BLAST
Topological domaini290 – 2912Mitochondrial intermembrane Reviewed prediction

GO - Cellular componenti

  1. cell junction Source: UniProtKB-KW
  2. integral component of mitochondrial membrane Source: Ensembl
  3. mitochondrial outer membrane Source: MGI
  4. mitochondrion Source: UniProtKB
  5. peroxisome Source: UniProtKB
  6. synaptic vesicle Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cytoplasmic vesicle, Membrane, Mitochondrion, Mitochondrion outer membrane, Peroxisome, Synapse

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 291291Mitochondrial fission factor
PRO_0000289185Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei89 – 891Phosphothreonine By similarity
Modified residuei129 – 1291Phosphoserine By similarity
Modified residuei131 – 1311Phosphoserine By similarity
Modified residuei146 – 1461Phosphoserine1 Publication
Modified residuei149 – 1491Phosphothreonine By similarity
Modified residuei151 – 1511Phosphoserine By similarity
Modified residuei178 – 1781Phosphoserine By similarity
Modified residuei182 – 1821Phosphoserine By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ6PCP5.
PaxDbiQ6PCP5.
PRIDEiQ6PCP5.

PTM databases

PhosphoSiteiQ6PCP5.

Expressioni

Gene expression databases

BgeeiQ6PCP5.
GenevestigatoriQ6PCP5.

Interactioni

Subunit structurei

Homodimer. Interacts with DNM1L By similarity.

Structurei

3D structure databases

ProteinModelPortaliQ6PCP5.

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili240 – 27132 Reviewed prediction
Add
BLAST

Sequence similaritiesi

Belongs to the Tango11 family.

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG43415.
GeneTreeiENSGT00390000009776.
HOGENOMiHOG000285976.
HOVERGENiHBG105704.
InParanoidiQ6PCP5.
OrthoDBiEOG7FV3QK.
PhylomeDBiQ6PCP5.
TreeFamiTF325506.

Family and domain databases

InterProiIPR008518. FATE/Miff/Tango-11.
[Graphical view]
PANTHERiPTHR16501. PTHR16501. 1 hit.
PfamiPF05644. Miff. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6PCP5-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAEISRIQYE MEYTEGISQR MRVPEKLKVA PPNADLEQEF QDGVPNASVI    50
MQVPERIVVT GNNEDISFSR PADLDLIQST PFKPLALKTP PRVLTLSERP 100
LDFLDLERPL PTPQSEESRA VGRLKRERSM SENAVRQNGQ LVRNDSIVTP 150
SPPQARVCPP HMLPEDGANL SSARGILSLI QSSTRRAYQQ ILDVLDENRR 200
PVLRGGSAAA TSNPHHDNVR YGISNLDAAI EGASDDMTVV DAASLRRQII 250
KLNRRLQLLE EENKERAKRE MVMYSITVAF WLLNSWLWFR R 291
Length:291
Mass (Da):32,931
Last modified:July 5, 2004 - v1
Checksum:i658884A1EF8EBCFD
GO
Isoform 2 (identifier: Q6PCP5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     117-117: E → EQ
     148-200: Missing.

Show »
Length:239
Mass (Da):27,222
Checksum:i2B5C47D0D90A5EEF
GO
Isoform 3 (identifier: Q6PCP5-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     148-200: Missing.

Show »
Length:238
Mass (Da):27,094
Checksum:i73E5E0480871D0AB
GO
Isoform 4 (identifier: Q6PCP5-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     147-220: IVTPSPPQARVCPPHMLPEDGANLSSARGILSLIQSSTRRAYQQILDVLDENRRPVLRGGSAAATSNPHHDNVR → M

Show »
Length:218
Mass (Da):25,074
Checksum:iC9E438153B01BC0C
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei117 – 1171E → EQ in isoform 2.
VSP_025959
Alternative sequencei147 – 22074IVTPS…HDNVR → M in isoform 4.
VSP_025960Add
BLAST
Alternative sequencei148 – 20053Missing in isoform 2 and isoform 3.
VSP_025961Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK017226 mRNA. Translation: BAB30643.1.
AK139649 mRNA. Translation: BAE24093.1.
BC016597 mRNA. Translation: AAH16597.1.
BC059229 mRNA. Translation: AAH59229.1.
CCDSiCCDS15098.1. [Q6PCP5-1]
RefSeqiNP_083685.2. NM_029409.2. [Q6PCP5-1]
XP_006496633.1. XM_006496570.1. [Q6PCP5-2]
XP_006496634.1. XM_006496571.1. [Q6PCP5-3]
XP_006496636.1. XM_006496573.1. [Q6PCP5-4]
UniGeneiMm.396863.

Genome annotation databases

EnsembliENSMUST00000073025; ENSMUSP00000072784; ENSMUSG00000026150. [Q6PCP5-2]
ENSMUST00000078332; ENSMUSP00000077446; ENSMUSG00000026150. [Q6PCP5-1]
ENSMUST00000160786; ENSMUSP00000125230; ENSMUSG00000026150. [Q6PCP5-3]
ENSMUST00000160972; ENSMUSP00000124200; ENSMUSG00000026150. [Q6PCP5-4]
GeneIDi75734.
KEGGimmu:75734.
UCSCiuc007brx.1. mouse. [Q6PCP5-1]
uc007bry.1. mouse. [Q6PCP5-3]
uc007brz.1. mouse. [Q6PCP5-2]
uc007bsc.1. mouse. [Q6PCP5-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK017226 mRNA. Translation: BAB30643.1 .
AK139649 mRNA. Translation: BAE24093.1 .
BC016597 mRNA. Translation: AAH16597.1 .
BC059229 mRNA. Translation: AAH59229.1 .
CCDSi CCDS15098.1. [Q6PCP5-1 ]
RefSeqi NP_083685.2. NM_029409.2. [Q6PCP5-1 ]
XP_006496633.1. XM_006496570.1. [Q6PCP5-2 ]
XP_006496634.1. XM_006496571.1. [Q6PCP5-3 ]
XP_006496636.1. XM_006496573.1. [Q6PCP5-4 ]
UniGenei Mm.396863.

3D structure databases

ProteinModelPortali Q6PCP5.
ModBasei Search...

PTM databases

PhosphoSitei Q6PCP5.

Proteomic databases

MaxQBi Q6PCP5.
PaxDbi Q6PCP5.
PRIDEi Q6PCP5.

Protocols and materials databases

DNASUi 75734.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000073025 ; ENSMUSP00000072784 ; ENSMUSG00000026150 . [Q6PCP5-2 ]
ENSMUST00000078332 ; ENSMUSP00000077446 ; ENSMUSG00000026150 . [Q6PCP5-1 ]
ENSMUST00000160786 ; ENSMUSP00000125230 ; ENSMUSG00000026150 . [Q6PCP5-3 ]
ENSMUST00000160972 ; ENSMUSP00000124200 ; ENSMUSG00000026150 . [Q6PCP5-4 ]
GeneIDi 75734.
KEGGi mmu:75734.
UCSCi uc007brx.1. mouse. [Q6PCP5-1 ]
uc007bry.1. mouse. [Q6PCP5-3 ]
uc007brz.1. mouse. [Q6PCP5-2 ]
uc007bsc.1. mouse. [Q6PCP5-4 ]

Organism-specific databases

CTDi 56947.
MGIi MGI:1922984. Mff.

Phylogenomic databases

eggNOGi NOG43415.
GeneTreei ENSGT00390000009776.
HOGENOMi HOG000285976.
HOVERGENi HBG105704.
InParanoidi Q6PCP5.
OrthoDBi EOG7FV3QK.
PhylomeDBi Q6PCP5.
TreeFami TF325506.

Miscellaneous databases

ChiTaRSi MFF. mouse.
NextBioi 343810.
PROi Q6PCP5.
SOURCEi Search...

Gene expression databases

Bgeei Q6PCP5.
Genevestigatori Q6PCP5.

Family and domain databases

InterProi IPR008518. FATE/Miff/Tango-11.
[Graphical view ]
PANTHERi PTHR16501. PTHR16501. 1 hit.
Pfami PF05644. Miff. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Strain: C57BL/6J.
    Tissue: Egg and Xiphoid cartilage.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4).
    Strain: C57BL/6 and FVB/N.
    Tissue: Brain and Mammary tumor.
  3. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-146, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  4. "Fis1, Mff, MiD49, and MiD51 mediate Drp1 recruitment in mitochondrial fission."
    Loson O.C., Song Z., Chen H., Chan D.C.
    Mol. Biol. Cell 24:659-667(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.

Entry informationi

Entry nameiMFF_MOUSE
AccessioniPrimary (citable) accession number: Q6PCP5
Secondary accession number(s): Q3UT87, Q91VG0, Q9D3P5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: July 5, 2004
Last modified: July 9, 2014
This is version 75 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi