Reviewed,
UniProtKB/Swiss-Prot Q6PB93 (GALT2_MOUSE)
Last modified
January 19, 2010.
Version 65.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Polypeptide N-acetylgalactosaminyltransferase 2 EC=2.4.1.41 Alternative name(s): Polypeptide GalNAc transferase 2 Short name=pp-GaNTase 2 Short name=GalNAc-T2 Protein-UDP acetylgalactosaminyltransferase 2 UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 2 Cleaved into the following chain: 1- Recommended name: Polypeptide N-acetylgalactosaminyltransferase 2 soluble form | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 570 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Has a broad spectrum of substrates for peptides such as EA2, Muc5AC, Muc1a, Muc1b. Probably involved in O-linked glycosylation of the immunoglobulin A1 (IgA1) hinge region By similarity. |
| Catalytic activity | UDP-N-acetyl-D-galactosamine + polypeptide = UDP + N-acetyl-D-galactosaminyl-polypeptide. |
| Cofactor | Manganese By similarity. Calcium By similarity. |
| Pathway | |
| Subcellular location | Golgi apparatus › Golgi stack membrane; Single-pass type II membrane protein. Secreted. Note: Resides preferentially in the trans and medial parts of the Golgi stack. A secreted form also exists. |
| Tissue specificity | Widely expressed at high level. Ref.4 |
| Domain | There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding By similarity. The ricin B-type lectin domain binds to GalNAc and contributes to the glycopeptide specificity By similarity. |
| Sequence similarities | Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily. Contains 1 ricin B-type lectin domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Golgi apparatus Membrane Secreted |
| Coding sequence diversity | Alternative splicing |
| Domain | Signal-anchor Transmembrane |
| Ligand | Calcium Lectin Manganese |
| Molecular function | Glycosyltransferase Transferase |
| PTM | Disulfide bond Glycoprotein |
| Gene Ontology (GO) | |
| Cellular component | Golgi lumen Traceable author statement. Source: MGI extracellular regionInferred from electronic annotation. Source: UniProtKB-SubCell integral to membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | calcium ion binding Inferred from electronic annotation. Source: UniProtKB-KW manganese ion bindingInferred from electronic annotation. Source: UniProtKB-KW polypeptide N-acetylgalactosaminyltransferase activityInferred from electronic annotation. Source: EC sugar bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6PB93-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6PB93-2) The sequence of this isoform differs from the canonical sequence as follows: 1-41: MRRRSRMLLCFALLWVLGIAYYMYSGGGSALAAGGGGAGRK → MALHNPQ | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 570 | 570 | Polypeptide N-acetylgalactosaminyltransferase 2 | PRO_0000223392 | |||||||
| Chain | 51 – 570 | 520 | Polypeptide N-acetylgalactosaminyltransferase 2 soluble form | PRO_0000012267 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 6 | 6 | Cytoplasmic Potential | ||||||||
| Transmembrane | 7 – 24 | 18 | Signal-anchor for type II membrane protein Potential | ||||||||
| Topological domain | 25 – 570 | 546 | Lumenal Potential | ||||||||
| Domain | 442 – 565 | 124 | Ricin B-type lectin | ||||||||
| Region | 134 – 239 | 106 | Catalytic subdomain A | ||||||||
| Region | 299 – 361 | 63 | Catalytic subdomain B | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 515 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 455 ↔ 472 | By similarity | |||||||||
| Disulfide bond | 495 ↔ 512 | By similarity | |||||||||
| Disulfide bond | 538 ↔ 554 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 41 | 41 | MRRRS…GAGRK → MALHNPQ in isoform 2. | VSP_011201 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 2 | 1 | R → L in AAK37548. Ref.1 | ||||||||
| Sequence conflict | 226 | 1 | C → Y in BAC32790. Ref.2 | ||||||||
| Sequence conflict | 516 – 518 | 3 | DSR → NSK in AAK37548. Ref.1 | ||||||||
| Sequence conflict | 564 | 1 | F → V in AAK37548. Ref.1 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | Miyahara N., Kanoh A., Irimura T. Submitted (FEB-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Colon adenocarcinoma. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: C57BL/6J. Tissue: Adipose tissue. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Strain: C57BL/6 and Czech II. Tissue: Brain and Mammary tumor. |
| [4] | "Expression of UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase isoforms in murine tissues determined by real-time PCR: a new view of a large family." Young W.W. Jr., Holcomb D.R., Ten Hagen K.G., Tabak L.A. Glycobiology 13:549-557(2003) [PubMed: 12651884] [Abstract] Cited for: TISSUE SPECIFICITY. |
| + | Additional computationally mapped references. |
Web resources
| Functional Glycomics Gateway - GTase Polypeptide N-acetylgalactosaminyltransferase 2 |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF348968 mRNA. Translation: AAK37548.1. AK046567 mRNA. Translation: BAC32790.1. BC007172 mRNA. Translation: AAH07172.1. BC053063 mRNA. Translation: AAH53063.1. BC059818 mRNA. Translation: AAH59818.1. |
| IPI | IPI00420710. IPI00460865. |
| RefSeq | NP_644678.2. |
| UniGene | Mm.33808 |
3D structure databases | |
| SMR | Q6PB93. Positions 40-566, 74-567. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q6PB93. |
Protein family/group databases | |
| CAZy | CBM13. Carbohydrate-Binding Module Family 13. GT27. Glycosyltransferase Family 27. |
Proteomic databases | |
| PRIDE | Q6PB93. |
Genome annotation databases | |
| Ensembl | ENSMUST00000034458; ENSMUSP00000034458; ENSMUSG00000031977; Mus musculus. [Genome view] |
| GeneID | 108148. |
| KEGG | mmu:108148. |
| UCSC | uc009nwz.1. mouse. |
Organism-specific databases | |
| CTD | 108148. |
| MGI | MGI:894694. Galnt2. |
Phylogenomic databases | |
| HOVERGEN | Q6PB93. |
| InParanoid | Q6PB93. |
| OMA | QRRSRQG. |
| OrthoDB | EOG9HB161. |
| PhylomeDB | Q6PB93. |
Enzyme and pathway databases | |
| BRENDA | 2.4.1.41. 244. |
Gene expression databases | |
| ArrayExpress | Q6PB93. |
| Bgee | Q6PB93. |
| Genevestigator | Q6PB93. |
| GermOnline | ENSMUSG00000031977. Mus musculus. |
Family and domain databases | |
| InterPro | IPR001173. Glyco_trans_2. IPR008997. Ricin_B-rel_lectin. IPR000772. Ricin_B_lectin. [Graphical view] |
| Pfam | PF00535. Glycos_transf_2. 1 hit. PF00652. Ricin_B_lectin. 1 hit. [Graphical view] |
| SMART | SM00458. RICIN. 1 hit. [Graphical view] |
| PROSITE | PS50231. RICIN_B_LECTIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 360162. |
| SOURCE | Search... |
Entry information
| Entry name | GALT2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q6PB93 Secondary accession number(s): Q7TSI5 Q99ME1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with


