Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

UPF0545 protein C22orf39

Gene

C22orf39

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Caution

It is uncertain whether Met-1 or Met-38 is the initiator. Orthologous sequences cannot be extended.Curated

Names & Taxonomyi

Protein namesi
Recommended name:
UPF0545 protein C22orf39
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

EuPathDBiHostDB:ENSG00000242259.8
HGNCiHGNC:27012 C22orf39
neXtProtiNX_Q6P5X5

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000242259
PharmGKBiPA162378995

Polymorphism and mutation databases

BioMutaiC22orf39
DMDMi510120816

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003261301 – 142UPF0545 protein C22orf39Add BLAST142

Proteomic databases

EPDiQ6P5X5
MaxQBiQ6P5X5
PaxDbiQ6P5X5
PeptideAtlasiQ6P5X5
PRIDEiQ6P5X5

PTM databases

iPTMnetiQ6P5X5
PhosphoSitePlusiQ6P5X5

Expressioni

Gene expression databases

BgeeiENSG00000242259
CleanExiHS_C22orf39
ExpressionAtlasiQ6P5X5 baseline and differential
GenevisibleiQ6P5X5 HS

Organism-specific databases

HPAiHPA073701

Interactioni

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi12617710 interactors.
IntActiQ6P5X5 30 interactors.
MINTiQ6P5X5
STRINGi9606.ENSP00000333064

Structurei

3D structure databases

ProteinModelPortaliQ6P5X5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the UPF0545 family.Curated

Phylogenomic databases

eggNOGiENOG410IZQS Eukaryota
ENOG4111T84 LUCA
GeneTreeiENSGT00390000002511
HOGENOMiHOG000112086
HOVERGENiHBG107786
InParanoidiQ6P5X5
OMAiHQYFIHG
OrthoDBiEOG091G0PGT
PhylomeDBiQ6P5X5
TreeFamiTF324380

Family and domain databases

InterProiView protein in InterPro
IPR021475 DUF3128
PANTHERiPTHR28052 PTHR28052, 1 hit
PfamiView protein in Pfam
PF11326 DUF3128, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6P5X5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MCRCSLVLLS VDHEVPFSSF FIGWRTEGRA WRAGRPDMAD GSGWQPPRPC
60 70 80 90 100
EAYRAEWKLC RSARHFLHHY YVHGERPACE QWQRDLASCR DWEERRNAEA
110 120 130 140
QQSLCESERA RVRAARKHIL VWAPRQSPPP DWHLPLPQEK DE
Length:142
Mass (Da):16,805
Last modified:May 29, 2013 - v2
Checksum:i1FA5A0AAE4CD6EDD
GO
Isoform 2 (identifier: Q6P5X5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     102-142: QSLCESERARVRAARKHILVWAPRQSPPPDWHLPLPQEKDE → VLSVVAHTCNLSYLGG

Show »
Length:117
Mass (Da):13,609
Checksum:i4C6B29CC50212B54
GO

Sequence cautioni

The sequence AAH62599 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAF82762 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAG30225 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence EAX03040 differs from that shown. Reason: Erroneous gene model prediction.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_046502102 – 142QSLCE…QEKDE → VLSVVAHTCNLSYLGG in isoform 2. CuratedAdd BLAST41

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK290073 mRNA Translation: BAF82762.1 Different initiation.
AC000068 Genomic DNA No translation available.
AC000079 Genomic DNA No translation available.
AC000085 Genomic DNA No translation available.
AC000092 Genomic DNA No translation available.
CH471176 Genomic DNA Translation: EAX03039.1
CH471176 Genomic DNA Translation: EAX03040.1 Sequence problems.
CH471176 Genomic DNA Translation: EAX03041.1
BC062599 mRNA Translation: AAH62599.1 Different initiation.
CR456339 mRNA Translation: CAG30225.1 Different initiation.
CCDSiCCDS33599.2 [Q6P5X5-1]
CCDS54498.1 [Q6P5X5-2]
RefSeqiNP_001159714.1, NM_001166242.1 [Q6P5X5-2]
NP_776154.3, NM_173793.4 [Q6P5X5-1]
UniGeneiHs.659565

Genome annotation databases

EnsembliENST00000399562; ENSP00000382474; ENSG00000242259 [Q6P5X5-1]
ENST00000542103; ENSP00000439212; ENSG00000242259 [Q6P5X5-2]
ENST00000611555; ENSP00000479673; ENSG00000242259 [Q6P5X5-1]
GeneIDi128977
KEGGihsa:128977
UCSCiuc002zpi.4 human [Q6P5X5-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCV039_HUMAN
AccessioniPrimary (citable) accession number: Q6P5X5
Secondary accession number(s): A8MTW6
, D3DX18, F5H3A8, J3KNP9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: May 29, 2013
Last modified: March 28, 2018
This is version 111 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome