Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

UPF0545 protein C22orf39

Gene

C22orf39

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
UPF0545 protein C22orf39
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

HGNCiHGNC:27012. C22orf39.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162378995.

Polymorphism and mutation databases

BioMutaiC22orf39.
DMDMi510120816.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 142142UPF0545 protein C22orf39PRO_0000326130Add
BLAST

Proteomic databases

EPDiQ6P5X5.
MaxQBiQ6P5X5.
PaxDbiQ6P5X5.
PeptideAtlasiQ6P5X5.
PRIDEiQ6P5X5.

PTM databases

iPTMnetiQ6P5X5.
PhosphoSiteiQ6P5X5.

Expressioni

Gene expression databases

BgeeiQ6P5X5.
CleanExiHS_C22orf39.
ExpressionAtlasiQ6P5X5. baseline and differential.
GenevisibleiQ6P5X5. HS.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
BANPQ8N9N53EBI-7317823,EBI-744695
CEP76Q8TAP63EBI-7317823,EBI-742887
MDFIQ997503EBI-7317823,EBI-724076
RBPMSQ930623EBI-7317823,EBI-740322

Protein-protein interaction databases

BioGridi126177. 7 interactions.
IntActiQ6P5X5. 6 interactions.
MINTiMINT-6776769.
STRINGi9606.ENSP00000333064.

Structurei

3D structure databases

ProteinModelPortaliQ6P5X5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the UPF0545 family.Curated

Phylogenomic databases

eggNOGiENOG410IZQS. Eukaryota.
ENOG4111T84. LUCA.
GeneTreeiENSGT00390000002511.
HOGENOMiHOG000112086.
HOVERGENiHBG107786.
InParanoidiQ6P5X5.
OMAiHHYYTYG.
PhylomeDBiQ6P5X5.
TreeFamiTF324380.

Family and domain databases

InterProiIPR021475. DUF3128.
[Graphical view]
PfamiPF11326. DUF3128. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6P5X5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MCRCSLVLLS VDHEVPFSSF FIGWRTEGRA WRAGRPDMAD GSGWQPPRPC
60 70 80 90 100
EAYRAEWKLC RSARHFLHHY YVHGERPACE QWQRDLASCR DWEERRNAEA
110 120 130 140
QQSLCESERA RVRAARKHIL VWAPRQSPPP DWHLPLPQEK DE
Length:142
Mass (Da):16,805
Last modified:May 29, 2013 - v2
Checksum:i1FA5A0AAE4CD6EDD
GO
Isoform 2 (identifier: Q6P5X5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     102-142: QSLCESERARVRAARKHILVWAPRQSPPPDWHLPLPQEKDE → VLSVVAHTCNLSYLGG

Show »
Length:117
Mass (Da):13,609
Checksum:i4C6B29CC50212B54
GO

Sequence cautioni

The sequence AAH62599.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAF82762.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAG30225.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence EAX03040.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei102 – 14241QSLCE…QEKDE → VLSVVAHTCNLSYLGG in isoform 2. CuratedVSP_046502Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK290073 mRNA. Translation: BAF82762.1. Different initiation.
AC000068 Genomic DNA. No translation available.
AC000079 Genomic DNA. No translation available.
AC000085 Genomic DNA. No translation available.
AC000092 Genomic DNA. No translation available.
CH471176 Genomic DNA. Translation: EAX03039.1.
CH471176 Genomic DNA. Translation: EAX03040.1. Sequence problems.
CH471176 Genomic DNA. Translation: EAX03041.1.
BC062599 mRNA. Translation: AAH62599.1. Different initiation.
CR456339 mRNA. Translation: CAG30225.1. Different initiation.
CCDSiCCDS33599.2. [Q6P5X5-1]
CCDS54498.1. [Q6P5X5-2]
RefSeqiNP_001159714.1. NM_001166242.1. [Q6P5X5-2]
NP_776154.3. NM_173793.4. [Q6P5X5-1]
UniGeneiHs.659565.

Genome annotation databases

EnsembliENST00000399562; ENSP00000382474; ENSG00000242259. [Q6P5X5-1]
ENST00000542103; ENSP00000439212; ENSG00000242259. [Q6P5X5-2]
ENST00000611555; ENSP00000479673; ENSG00000242259. [Q6P5X5-1]
GeneIDi128977.
KEGGihsa:128977.
UCSCiuc002zpi.4. human. [Q6P5X5-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK290073 mRNA. Translation: BAF82762.1. Different initiation.
AC000068 Genomic DNA. No translation available.
AC000079 Genomic DNA. No translation available.
AC000085 Genomic DNA. No translation available.
AC000092 Genomic DNA. No translation available.
CH471176 Genomic DNA. Translation: EAX03039.1.
CH471176 Genomic DNA. Translation: EAX03040.1. Sequence problems.
CH471176 Genomic DNA. Translation: EAX03041.1.
BC062599 mRNA. Translation: AAH62599.1. Different initiation.
CR456339 mRNA. Translation: CAG30225.1. Different initiation.
CCDSiCCDS33599.2. [Q6P5X5-1]
CCDS54498.1. [Q6P5X5-2]
RefSeqiNP_001159714.1. NM_001166242.1. [Q6P5X5-2]
NP_776154.3. NM_173793.4. [Q6P5X5-1]
UniGeneiHs.659565.

3D structure databases

ProteinModelPortaliQ6P5X5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126177. 7 interactions.
IntActiQ6P5X5. 6 interactions.
MINTiMINT-6776769.
STRINGi9606.ENSP00000333064.

PTM databases

iPTMnetiQ6P5X5.
PhosphoSiteiQ6P5X5.

Polymorphism and mutation databases

BioMutaiC22orf39.
DMDMi510120816.

Proteomic databases

EPDiQ6P5X5.
MaxQBiQ6P5X5.
PaxDbiQ6P5X5.
PeptideAtlasiQ6P5X5.
PRIDEiQ6P5X5.

Protocols and materials databases

DNASUi128977.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000399562; ENSP00000382474; ENSG00000242259. [Q6P5X5-1]
ENST00000542103; ENSP00000439212; ENSG00000242259. [Q6P5X5-2]
ENST00000611555; ENSP00000479673; ENSG00000242259. [Q6P5X5-1]
GeneIDi128977.
KEGGihsa:128977.
UCSCiuc002zpi.4. human. [Q6P5X5-1]

Organism-specific databases

CTDi128977.
GeneCardsiC22orf39.
HGNCiHGNC:27012. C22orf39.
neXtProtiNX_Q6P5X5.
PharmGKBiPA162378995.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IZQS. Eukaryota.
ENOG4111T84. LUCA.
GeneTreeiENSGT00390000002511.
HOGENOMiHOG000112086.
HOVERGENiHBG107786.
InParanoidiQ6P5X5.
OMAiHHYYTYG.
PhylomeDBiQ6P5X5.
TreeFamiTF324380.

Miscellaneous databases

GenomeRNAii128977.
PROiQ6P5X5.

Gene expression databases

BgeeiQ6P5X5.
CleanExiHS_C22orf39.
ExpressionAtlasiQ6P5X5. baseline and differential.
GenevisibleiQ6P5X5. HS.

Family and domain databases

InterProiIPR021475. DUF3128.
[Graphical view]
PfamiPF11326. DUF3128. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Substantia nigra.
  2. "The DNA sequence of human chromosome 22."
    Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M.
    , Buck D., Burgess J., Burrill W.D., Burton J., Carder C., Carter N.P., Chen Y., Clark G., Clegg S.M., Cobley V.E., Cole C.G., Collier R.E., Connor R., Conroy D., Corby N.R., Coville G.J., Cox A.V., Davis J., Dawson E., Dhami P.D., Dockree C., Dodsworth S.J., Durbin R.M., Ellington A.G., Evans K.L., Fey J.M., Fleming K., French L., Garner A.A., Gilbert J.G.R., Goward M.E., Grafham D.V., Griffiths M.N.D., Hall C., Hall R.E., Hall-Tamlyn G., Heathcott R.W., Ho S., Holmes S., Hunt S.E., Jones M.C., Kershaw J., Kimberley A.M., King A., Laird G.K., Langford C.F., Leversha M.A., Lloyd C., Lloyd D.M., Martyn I.D., Mashreghi-Mohammadi M., Matthews L.H., Mccann O.T., Mcclay J., Mclaren S., McMurray A.A., Milne S.A., Mortimore B.J., Odell C.N., Pavitt R., Pearce A.V., Pearson D., Phillimore B.J.C.T., Phillips S.H., Plumb R.W., Ramsay H., Ramsey Y., Rogers L., Ross M.T., Scott C.E., Sehra H.K., Skuce C.D., Smalley S., Smith M.L., Soderlund C., Spragon L., Steward C.A., Sulston J.E., Swann R.M., Vaudin M., Wall M., Wallis J.M., Whiteley M.N., Willey D.L., Williams L., Williams S.A., Williamson H., Wilmer T.E., Wilming L., Wright C.L., Hubbard T., Bentley D.R., Beck S., Rogers J., Shimizu N., Minoshima S., Kawasaki K., Sasaki T., Asakawa S., Kudoh J., Shintani A., Shibuya K., Yoshizaki Y., Aoki N., Mitsuyama S., Roe B.A., Chen F., Chu L., Crabtree J., Deschamps S., Do A., Do T., Dorman A., Fang F., Fu Y., Hu P., Hua A., Kenton S., Lai H., Lao H.I., Lewis J., Lewis S., Lin S.-P., Loh P., Malaj E., Nguyen T., Pan H., Phan S., Qi S., Qian Y., Ray L., Ren Q., Shaull S., Sloan D., Song L., Wang Q., Wang Y., Wang Z., White J., Willingham D., Wu H., Yao Z., Zhan M., Zhang G., Chissoe S., Murray J., Miller N., Minx P., Fulton R., Johnson D., Bemis G., Bentley D., Bradshaw H., Bourne S., Cordes M., Du Z., Fulton L., Goela D., Graves T., Hawkins J., Hinds K., Kemp K., Latreille P., Layman D., Ozersky P., Rohlfing T., Scheet P., Walker C., Wamsley A., Wohldmann P., Pepin K., Nelson J., Korf I., Bedell J.A., Hillier L.W., Mardis E., Waterston R., Wilson R., Emanuel B.S., Shaikh T., Kurahashi H., Saitta S., Budarf M.L., McDermid H.E., Johnson A., Wong A.C.C., Morrow B.E., Edelmann L., Kim U.J., Shizuya H., Simon M.I., Dumanski J.P., Peyrard M., Kedra D., Seroussi E., Fransson I., Tapia I., Bruder C.E., O'Brien K.P., Wilkinson P., Bodenteich A., Hartman K., Hu X., Khan A.S., Lane L., Tilahun Y., Wright H.
    Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 35-105 (ISOFORM 1).
    Tissue: Brain.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 37-105 (ISOFORM 1).

Entry informationi

Entry nameiCV039_HUMAN
AccessioniPrimary (citable) accession number: Q6P5X5
Secondary accession number(s): A8MTW6
, D3DX18, F5H3A8, J3KNP9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: May 29, 2013
Last modified: July 6, 2016
This is version 100 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

It is uncertain whether Met-1 or Met-38 is the initiator. Orthologous sequences cannot be extended.Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.