Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

MBT domain-containing protein 1

Gene

Mbtd1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Putative Polycomb group (PcG) protein. PcG proteins maintain the transcriptionally repressive state of genes, probably via a modification of chromatin, rendering it heritably changed in its expressibility. Specifically binds to monomethylated and dimethylated 'Lys-20' on histone H4 (By similarity).By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri45 – 8036FCS-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Chromatin regulator

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
MBT domain-containing protein 1
Gene namesi
Name:Mbtd1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:2143977. Mbtd1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 631631MBT domain-containing protein 1PRO_0000313718Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei115 – 1151N6-acetyllysineCombined sources

Keywords - PTMi

Acetylation

Proteomic databases

MaxQBiQ6P5G3.
PaxDbiQ6P5G3.
PeptideAtlasiQ6P5G3.
PRIDEiQ6P5G3.

PTM databases

PhosphoSiteiQ6P5G3.

Expressioni

Gene expression databases

BgeeiENSMUSG00000059474.
CleanExiMM_MBTD1.
ExpressionAtlasiQ6P5G3. baseline and differential.
GenevisibleiQ6P5G3. MM.

Interactioni

Subunit structurei

Monomer.By similarity

Protein-protein interaction databases

BioGridi222109. 4 interactions.
IntActiQ6P5G3. 1 interaction.
STRINGi10090.ENSMUSP00000103485.

Structurei

3D structure databases

ProteinModelPortaliQ6P5G3.
SMRiQ6P5G3. Positions 138-583.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati144 – 248105MBT 1Add
BLAST
Repeati256 – 35398MBT 2Add
BLAST
Repeati354 – 459106MBT 3Add
BLAST
Repeati467 – 56397MBT 4Add
BLAST

Sequence similaritiesi

Contains 1 FCS-type zinc finger.PROSITE-ProRule annotation
Contains 4 MBT repeats.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri45 – 8036FCS-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiENOG410IMEY. Eukaryota.
ENOG410ZCJZ. LUCA.
GeneTreeiENSGT00760000119024.
HOGENOMiHOG000231220.
HOVERGENiHBG057974.
InParanoidiQ6P5G3.
OMAiYYIKQEP.
OrthoDBiEOG091G0312.
TreeFamiTF316498.

Family and domain databases

InterProiIPR004092. Mbt.
IPR012313. Znf_FCS.
[Graphical view]
PfamiPF02820. MBT. 4 hits.
[Graphical view]
SMARTiSM00561. MBT. 4 hits.
[Graphical view]
PROSITEiPS51079. MBT. 4 hits.
PS51024. ZF_FCS. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6P5G3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFDGYDSCSE DTSSSSSSEE SEEEVAPLPS NLPIIKNNGQ VYTYPDGKSG
60 70 80 90 100
MATCEMCGMV GVRDAFYSKT KRFCSVSCSR SYSSNSKKAS ILARLQGKPP
110 120 130 140 150
TKKAKVLQKQ PLVAKLAAYA QYQATLQNQA KTKAGNSAIS VEGFSWGNYI
160 170 180 190 200
NSNSFIAAPV ACFKHAPMGT CWGDISENVR IEVPNTDCSL PTKVFWIAGI
210 220 230 240 250
IKLAGYNALL RYEGFENDSS LDFWCNICGS DIHPVGWCAA SGKPLVPPRT
260 270 280 290 300
VQHKYTNWKA FLVKRLTGAK TLPPDFSQKV SESMQYPFKP CMRVEVVDKR
310 320 330 340 350
HLCRTRVAVV ESVIGGRLRL VYEESEDRTD DFWCHMHSPL IHHIGWSRSI
360 370 380 390 400
GHRFKRSDIT KKQDGHFDTP PHLFAKVKEV DQSGEWFKEG MKLEAIDPLN
410 420 430 440 450
LSTICVATIR KVLADGFLMI GIDGSEAADG SDWFCYHATS PSIFPVGFCE
460 470 480 490 500
INMIELTPPR GYTKLPFKWF DYLRETGSIA APVKLFNKDV PNHGFRVGMK
510 520 530 540 550
LEAVDLMEPR LICVATVTRI IHRLLRIHFD GWEEEYDQWV DCESPDLYPV
560 570 580 590 600
GWCQLTGYQL QPPASQSSRE SQSASSKQKK KAKSQQYKGH KKMTTSQLKE
610 620 630
ELLDGEDYSF LHGASDQESN GSATVYIKQE P
Length:631
Mass (Da):70,669
Last modified:July 5, 2004 - v1
Checksum:i6F6018713F7FB83A
GO
Isoform 2 (identifier: Q6P5G3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MITAIKKQNILHNPKEKADWFGM
     593-631: MTTSQLKEELLDGEDYSFLHGASDQESNGSATVYIKQEP → STEEMTES

Note: No experimental confirmation available.
Show »
Length:622
Mass (Da):69,828
Checksum:i74FE651BE3E0F6A4
GO

Sequence cautioni

The sequence AAH20018 differs from that shown. Reason: Erroneous initiation. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MITAIKKQNILHNPKEKADW FGM in isoform 2. 1 PublicationVSP_030119
Alternative sequencei593 – 63139MTTSQ…IKQEP → STEEMTES in isoform 2. 1 PublicationVSP_030120Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL663078, AL662838 Genomic DNA. Translation: CAI25711.1.
AL663078, AL662838 Genomic DNA. Translation: CAI25714.1.
AL662838, AL663078 Genomic DNA. Translation: CAI35368.1.
AL662838, AL663078 Genomic DNA. Translation: CAI35371.1.
BC020018 mRNA. Translation: AAH20018.1. Different initiation.
BC062907 mRNA. Translation: AAH62907.1.
BC064014 mRNA. Translation: AAH64014.1.
CCDSiCCDS48883.1. [Q6P5G3-1]
RefSeqiNP_598773.2. NM_134012.3. [Q6P5G3-1]
XP_006531973.1. XM_006531910.2. [Q6P5G3-1]
XP_006531974.1. XM_006531911.2. [Q6P5G3-2]
UniGeneiMm.210334.

Genome annotation databases

EnsembliENSMUST00000063718; ENSMUSP00000065442; ENSMUSG00000059474. [Q6P5G3-2]
ENSMUST00000107853; ENSMUSP00000103485; ENSMUSG00000059474. [Q6P5G3-1]
ENSMUST00000107854; ENSMUSP00000103486; ENSMUSG00000059474. [Q6P5G3-1]
GeneIDi103537.
KEGGimmu:103537.
UCSCiuc007kxn.2. mouse. [Q6P5G3-2]
uc007kxo.2. mouse. [Q6P5G3-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL663078, AL662838 Genomic DNA. Translation: CAI25711.1.
AL663078, AL662838 Genomic DNA. Translation: CAI25714.1.
AL662838, AL663078 Genomic DNA. Translation: CAI35368.1.
AL662838, AL663078 Genomic DNA. Translation: CAI35371.1.
BC020018 mRNA. Translation: AAH20018.1. Different initiation.
BC062907 mRNA. Translation: AAH62907.1.
BC064014 mRNA. Translation: AAH64014.1.
CCDSiCCDS48883.1. [Q6P5G3-1]
RefSeqiNP_598773.2. NM_134012.3. [Q6P5G3-1]
XP_006531973.1. XM_006531910.2. [Q6P5G3-1]
XP_006531974.1. XM_006531911.2. [Q6P5G3-2]
UniGeneiMm.210334.

3D structure databases

ProteinModelPortaliQ6P5G3.
SMRiQ6P5G3. Positions 138-583.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi222109. 4 interactions.
IntActiQ6P5G3. 1 interaction.
STRINGi10090.ENSMUSP00000103485.

PTM databases

PhosphoSiteiQ6P5G3.

Proteomic databases

MaxQBiQ6P5G3.
PaxDbiQ6P5G3.
PeptideAtlasiQ6P5G3.
PRIDEiQ6P5G3.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000063718; ENSMUSP00000065442; ENSMUSG00000059474. [Q6P5G3-2]
ENSMUST00000107853; ENSMUSP00000103485; ENSMUSG00000059474. [Q6P5G3-1]
ENSMUST00000107854; ENSMUSP00000103486; ENSMUSG00000059474. [Q6P5G3-1]
GeneIDi103537.
KEGGimmu:103537.
UCSCiuc007kxn.2. mouse. [Q6P5G3-2]
uc007kxo.2. mouse. [Q6P5G3-1]

Organism-specific databases

CTDi54799.
MGIiMGI:2143977. Mbtd1.

Phylogenomic databases

eggNOGiENOG410IMEY. Eukaryota.
ENOG410ZCJZ. LUCA.
GeneTreeiENSGT00760000119024.
HOGENOMiHOG000231220.
HOVERGENiHBG057974.
InParanoidiQ6P5G3.
OMAiYYIKQEP.
OrthoDBiEOG091G0312.
TreeFamiTF316498.

Miscellaneous databases

ChiTaRSiMbtd1. mouse.
PROiQ6P5G3.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000059474.
CleanExiMM_MBTD1.
ExpressionAtlasiQ6P5G3. baseline and differential.
GenevisibleiQ6P5G3. MM.

Family and domain databases

InterProiIPR004092. Mbt.
IPR012313. Znf_FCS.
[Graphical view]
PfamiPF02820. MBT. 4 hits.
[Graphical view]
SMARTiSM00561. MBT. 4 hits.
[Graphical view]
PROSITEiPS51079. MBT. 4 hits.
PS51024. ZF_FCS. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMBTD1_MOUSE
AccessioniPrimary (citable) accession number: Q6P5G3
Secondary accession number(s): Q6P3F0, Q8VE12
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: July 5, 2004
Last modified: September 7, 2016
This is version 96 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.