Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ferredoxin-2, mitochondrial

Gene

FDX2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Essential for heme A and Fe/S protein biosynthesis.1 Publication

Cofactori

[2Fe-2S] clusterCombined sourcesNote: Binds 1 [2Fe-2S] cluster.Combined sources

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi105Iron-sulfur (2Fe-2S)PROSITE-ProRule annotationCombined sources1
Metal bindingi111Iron-sulfur (2Fe-2S)PROSITE-ProRule annotationCombined sources1
Metal bindingi114Iron-sulfur (2Fe-2S)PROSITE-ProRule annotationCombined sources1
Metal bindingi151Iron-sulfur (2Fe-2S)PROSITE-ProRule annotationCombined sources1

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Electron transport, Transport

Keywords - Ligandi

2Fe-2S, Iron, Iron-sulfur, Metal-binding

Enzyme and pathway databases

ReactomeiR-HSA-1362409. Mitochondrial iron-sulfur cluster biogenesis.
R-HSA-196108. Pregnenolone biosynthesis.
R-HSA-211976. Endogenous sterols.
R-HSA-2395516. Electron transport from NADPH to Ferredoxin.
R-HSA-5579026. Defective CYP11A1 causes Adrenal insufficiency, congenital, with 46,XY sex reversal (AICSR).

Names & Taxonomyi

Protein namesi
Recommended name:
Ferredoxin-2, mitochondrial1 Publication
Alternative name(s):
Adrenodoxin-like protein
Ferredoxin-1-like protein
Gene namesi
Name:FDX2Imported
Synonyms:FDX1L
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:30546. FDX2.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Mitochondrion

Pathology & Biotechi

Organism-specific databases

DisGeNETi112812.
OpenTargetsiENSG00000167807.
PharmGKBiPA162388212.

Polymorphism and mutation databases

BioMutaiFDX1L.
DMDMi74749111.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transit peptidei1 – 52MitochondrionSequence analysisAdd BLAST52
ChainiPRO_000032595253 – 183Ferredoxin-2, mitochondrialAdd BLAST131

Proteomic databases

EPDiQ6P4F2.
MaxQBiQ6P4F2.
PaxDbiQ6P4F2.
PeptideAtlasiQ6P4F2.
PRIDEiQ6P4F2.

PTM databases

iPTMnetiQ6P4F2.
PhosphoSitePlusiQ6P4F2.

Expressioni

Tissue specificityi

Widely expressed, with highest levels in testis, kidney and brain (at protein level).1 Publication

Gene expression databases

BgeeiENSG00000267673.
CleanExiHS_FDX1L.
ExpressionAtlasiQ6P4F2. baseline and differential.
GenevisibleiQ6P4F2. HS.

Organism-specific databases

HPAiHPA043986.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
LHX4Q969G23EBI-10252800,EBI-2865388

Protein-protein interaction databases

IntActiQ6P4F2. 2 interactors.
STRINGi9606.ENSP00000377311.

Structurei

Secondary structure

1183
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi67 – 73Combined sources7
Beta strandi79 – 85Combined sources7
Helixi90 – 96Combined sources7
Beta strandi106 – 110Combined sources5
Beta strandi115 – 118Combined sources4
Helixi120 – 123Combined sources4
Helixi131 – 138Combined sources8
Beta strandi147 – 149Combined sources3
Helixi150 – 152Combined sources3
Helixi157 – 159Combined sources3
Beta strandi163 – 165Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2Y5CX-ray1.70A/B66-171[»]
ProteinModelPortaliQ6P4F2.
SMRiQ6P4F2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini68 – 1702Fe-2S ferredoxin-typePROSITE-ProRule annotationAdd BLAST103

Sequence similaritiesi

Belongs to the adrenodoxin/putidaredoxin family.Curated
Contains 1 2Fe-2S ferredoxin-type domain.PROSITE-ProRule annotation

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiKOG3309. Eukaryota.
COG0633. LUCA.
GeneTreeiENSGT00530000063577.
HOGENOMiHOG000244518.
HOVERGENiHBG055801.
InParanoidiQ6P4F2.
OMAiNITFIDK.
OrthoDBiEOG091G0MJ2.
PhylomeDBiQ6P4F2.
TreeFamiTF354319.

Family and domain databases

CDDicd00207. fer2. 1 hit.
Gene3Di3.10.20.30. 1 hit.
InterProiIPR001041. 2Fe-2S_ferredoxin-type.
IPR001055. Adrenodoxin.
IPR018298. Adrenodoxin_Fe-S_BS.
IPR012675. Beta-grasp_dom.
[Graphical view]
PfamiPF00111. Fer2. 1 hit.
[Graphical view]
PRINTSiPR00355. ADRENODOXIN.
SUPFAMiSSF54292. SSF54292. 1 hit.
PROSITEiPS51085. 2FE2S_FER_2. 1 hit.
PS00814. ADX. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6P4F2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAASMARGGV SARVLLQAAR GTWWNRPGGT SGSGEGVALG TTRKFQATGS
60 70 80 90 100
RPAGEEDAGG PERPGDVVNV VFVDRSGQRI PVSGRVGDNV LHLAQRHGVD
110 120 130 140 150
LEGACEASLA CSTCHVYVSE DHLDLLPPPE EREDDMLDMA PLLQENSRLG
160 170 180
CQIVLTPELE GAEFTLPKIT RNFYVDGHVP KPH
Length:183
Mass (Da):19,521
Last modified:July 5, 2004 - v1
Checksum:i2B5F37C0061C65EF
GO
Isoform 2 (identifier: Q6P4F2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHVM
     133-183: EDDMLDMAPLLQENSRLGCQIVLTPELEGAEFTLPKITRNFYVDGHVPKPH → RTRGWAARLC

Note: No experimental confirmation available.
Show »
Length:145
Mass (Da):15,298
Checksum:i42D8FC3FA458AE05
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0568251M → MHVM in isoform 2. 1 Publication1
Alternative sequenceiVSP_056826133 – 183EDDML…VPKPH → RTRGWAARLC in isoform 2. 1 PublicationAdd BLAST51

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK097022 mRNA. Translation: BAC04929.1.
AC011511 Genomic DNA. No translation available.
BC063460 mRNA. Translation: AAH63460.1.
RefSeqiNP_001026904.2. NM_001031734.3.
UniGeneiHs.654865.

Genome annotation databases

EnsembliENST00000393708; ENSP00000377311; ENSG00000267673.
GeneIDi112812.
KEGGihsa:112812.
UCSCiuc002mny.2. human. [Q6P4F2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK097022 mRNA. Translation: BAC04929.1.
AC011511 Genomic DNA. No translation available.
BC063460 mRNA. Translation: AAH63460.1.
RefSeqiNP_001026904.2. NM_001031734.3.
UniGeneiHs.654865.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2Y5CX-ray1.70A/B66-171[»]
ProteinModelPortaliQ6P4F2.
SMRiQ6P4F2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ6P4F2. 2 interactors.
STRINGi9606.ENSP00000377311.

PTM databases

iPTMnetiQ6P4F2.
PhosphoSitePlusiQ6P4F2.

Polymorphism and mutation databases

BioMutaiFDX1L.
DMDMi74749111.

Proteomic databases

EPDiQ6P4F2.
MaxQBiQ6P4F2.
PaxDbiQ6P4F2.
PeptideAtlasiQ6P4F2.
PRIDEiQ6P4F2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000393708; ENSP00000377311; ENSG00000267673.
GeneIDi112812.
KEGGihsa:112812.
UCSCiuc002mny.2. human. [Q6P4F2-1]

Organism-specific databases

CTDi112812.
DisGeNETi112812.
GeneCardsiFDX1L.
HGNCiHGNC:30546. FDX2.
HPAiHPA043986.
MIMi614585. gene.
neXtProtiNX_Q6P4F2.
OpenTargetsiENSG00000167807.
PharmGKBiPA162388212.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3309. Eukaryota.
COG0633. LUCA.
GeneTreeiENSGT00530000063577.
HOGENOMiHOG000244518.
HOVERGENiHBG055801.
InParanoidiQ6P4F2.
OMAiNITFIDK.
OrthoDBiEOG091G0MJ2.
PhylomeDBiQ6P4F2.
TreeFamiTF354319.

Enzyme and pathway databases

ReactomeiR-HSA-1362409. Mitochondrial iron-sulfur cluster biogenesis.
R-HSA-196108. Pregnenolone biosynthesis.
R-HSA-211976. Endogenous sterols.
R-HSA-2395516. Electron transport from NADPH to Ferredoxin.
R-HSA-5579026. Defective CYP11A1 causes Adrenal insufficiency, congenital, with 46,XY sex reversal (AICSR).

Miscellaneous databases

GenomeRNAii112812.
PROiQ6P4F2.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000267673.
CleanExiHS_FDX1L.
ExpressionAtlasiQ6P4F2. baseline and differential.
GenevisibleiQ6P4F2. HS.

Family and domain databases

CDDicd00207. fer2. 1 hit.
Gene3Di3.10.20.30. 1 hit.
InterProiIPR001041. 2Fe-2S_ferredoxin-type.
IPR001055. Adrenodoxin.
IPR018298. Adrenodoxin_Fe-S_BS.
IPR012675. Beta-grasp_dom.
[Graphical view]
PfamiPF00111. Fer2. 1 hit.
[Graphical view]
PRINTSiPR00355. ADRENODOXIN.
SUPFAMiSSF54292. SSF54292. 1 hit.
PROSITEiPS51085. 2FE2S_FER_2. 1 hit.
PS00814. ADX. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiFDX2_HUMAN
AccessioniPrimary (citable) accession number: Q6P4F2
Secondary accession number(s): Q8N8B8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: July 5, 2004
Last modified: November 30, 2016
This is version 117 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.