Q6P4F1 (FUT10_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 65.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Alpha-(1,3)-fucosyltransferase 10 EC=2.4.1.- Alternative name(s): Fucosyltransferase X Short name=Fuc-TX Short name=FucT-X Galactoside 3-L-fucosyltransferase 10 Short name=Fucosyltransferase 10 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 479 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Probable fucosyltransferase By similarity. |
| Pathway | |
| Subcellular location | Golgi apparatus › Golgi stack membrane; Single-pass type II membrane protein Ref.6. |
| Sequence similarities | Belongs to the glycosyltransferase 10 family. |
| Sequence caution | The sequence CAD24023.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6P4F1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6P4F1-2) The sequence of this isoform differs from the canonical sequence as follows: 27-27: Q → ALDTVENLMKVTGPPQGVTDSMQCFNDQRPLSNTRSSEHIKE | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q6P4F1-3) The sequence of this isoform differs from the canonical sequence as follows: 1-62: Missing. 63-126: LKKEGLTFNR...HMTKAFLFYG → MGIGQLPHYA...ESPPLAENDG 405-419: GLPPKRWEAEDTHLS → VSKSKVGIEPAGWPS 420-479: Missing. | ||||||
| Isoform 4 (identifier: Q6P4F1-4) The sequence of this isoform differs from the canonical sequence as follows: 1-28: Missing. 405-419: GLPPKRWEAEDTHLS → VSKSKVGIEPAGWPS 420-479: Missing. | ||||||
| Isoform 5 (identifier: Q6P4F1-5) The sequence of this isoform differs from the canonical sequence as follows: 405-419: GLPPKRWEAEDTHLS → VSKSKVGIEPAGWPS 420-479: Missing. | ||||||
| Isoform 6 (identifier: Q6P4F1-6) The sequence of this isoform differs from the canonical sequence as follows: 1-28: Missing. | ||||||
| Isoform 7 (identifier: Q6P4F1-7) The sequence of this isoform differs from the canonical sequence as follows: 1-51: Missing. 127-143: TDFNIDSLPLPRKAHHD → KQDFRLSPLFAVVFLQS 144-479: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 479 | 479 | Alpha-(1,3)-fucosyltransferase 10 | PRO_0000299002 | |||||
Regions | |||||||||
| Topological domain | 1 – 8 | 8 | Cytoplasmic Potential | ||||||
| Transmembrane | 9 – 31 | 23 | Helical; Signal-anchor for type II membrane protein; Potential | ||||||
| Topological domain | 32 – 479 | 448 | Lumenal Potential | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 110 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 168 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 62 | 62 | Missing in isoform 3. | VSP_027498 | |||||
| Alternative sequence | 1 – 51 | 51 | Missing in isoform 7. | VSP_027499 | |||||
| Alternative sequence | 1 – 28 | 28 | Missing in isoform 4 and isoform 6. | VSP_027500 | |||||
| Alternative sequence | 27 | 1 | Q → ALDTVENLMKVTGPPQGVTD SMQCFNDQRPLSNTRSSEHI KE in isoform 2. | VSP_027501 | |||||
| Alternative sequence | 63 – 126 | 64 | LKKEG…FLFYG → MGIGQLPHYALVVPADGGDW EVRPMWSRCLFLHHQPDLPP SSHDQSIPLLWSQEESPPLA ENDG in isoform 3. | VSP_027502 | |||||
| Alternative sequence | 127 – 143 | 17 | TDFNI…KAHHD → KQDFRLSPLFAVVFLQS in isoform 7. | VSP_027503 | |||||
| Alternative sequence | 144 – 479 | 336 | Missing in isoform 7. | VSP_027504 | |||||
| Alternative sequence | 405 – 419 | 15 | GLPPK…DTHLS → VSKSKVGIEPAGWPS in isoform 3, isoform 4 and isoform 5. | VSP_027505 | |||||
| Alternative sequence | 420 – 479 | 60 | Missing in isoform 3, isoform 4 and isoform 5. | VSP_027506 | |||||
| Natural variant | 59 | 1 | L → F. Ref.1 Corresponds to variant rs16880994 [ dbSNP | Ensembl ]. | VAR_034759 | |||||
| Natural variant | 268 | 1 | Y → H. Corresponds to variant rs16880853 [ dbSNP | Ensembl ]. | VAR_034760 | |||||
| Natural variant | 368 | 1 | L → V. Ref.1 Ref.5 Corresponds to variant rs17855838 [ dbSNP | Ensembl ]. | VAR_034761 | |||||
| Natural variant | 371 | 1 | R → P. Ref.5 Corresponds to variant rs17855839 [ dbSNP | Ensembl ]. | VAR_034762 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Composition of Drosophila melanogaster proteome involved in fucosylated glycan metabolism." Roos C., Kolmer M., Mattila P., Renkonen R. J. Biol. Chem. 277:3168-3175(2002) [PubMed: 11698403] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6), VARIANTS PHE-59 AND VAL-368. Tissue: Brain. |
| [2] | "Cloning, expression and genomic organization of two new human alpha3-fucosyltransferases (FUT10 and FUT11)." Martinez-Duncker I., Candelier J.-J., Oriol R., Mollicone R. Submitted (SEP-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 3; 4 AND 5). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Trachea. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 7), VARIANTS VAL-368 AND PRO-371. Tissue: Brain and Ovary. |
| [6] | "Comparison of human and mouse Fuc-TX and Fuc-TXI genes, and expression studies in the mouse." Baboval T., Smith F.I. Mamm. Genome 13:538-541(2002) [PubMed: 12370785] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ431184 mRNA. Translation: CAD24023.1. Different initiation. AJ512465 mRNA. Translation: CAD54669.1. AJ535838 mRNA. Translation: CAD59771.1. AJ535839 mRNA. Translation: CAD59772.1. AJ582015 mRNA. Translation: CAE46499.1. AK292993 mRNA. Translation: BAF85682.1. CH471080 Genomic DNA. Translation: EAW63404.1. BC004884 mRNA. Translation: AAH04884.2. BC063462 mRNA. Translation: AAH63462.1. |
| IPI | IPI00152615. IPI00217027. IPI00440692. IPI00746897. IPI00855757. IPI00855877. IPI00855896. |
| RefSeq | NP_116053.3. NM_032664.3. |
| UniGene | Hs.458713. |
3D structure databases | |
| ProteinModelPortal | Q6P4F1. |
| SMR | Q6P4F1. Positions 210-394. |
| ModBase | Search... |
Protein family/group databases | |
| CAZy | GT10. Glycosyltransferase Family 10. |
PTM databases | |
| PhosphoSite | Q6P4F1. |
Polymorphism databases | |
| DMDM | 156630455. |
Proteomic databases | |
| PRIDE | Q6P4F1. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000327671; ENSP00000332757; ENSG00000172728. |
| GeneID | 84750. |
| KEGG | hsa:84750. |
| UCSC | uc003xjc.1. human. uc003xje.1. human. uc003xjf.2. human. uc003xjg.2. human. uc003xji.1. human. |
Organism-specific databases | |
| CTD | 84750. |
| GeneCards | GC08M033286. |
| H-InvDB | HIX0007444. |
| HGNC | HGNC:19234. FUT10. |
| neXtProt | NX_Q6P4F1. |
| PharmGKB | PA134872572. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG14916. |
| GeneTree | ENSGT00550000074250. |
| HOVERGEN | HBG055521. |
| PhylomeDB | Q6P4F1. |
Gene expression databases | |
| ArrayExpress | Q6P4F1. |
| Bgee | Q6P4F1. |
| CleanEx | HS_FUT10. |
| Genevestigator | Q6P4F1. |
Family and domain databases | |
| InterPro | IPR017176. Alpha-1_3-FUT_met. IPR001503. Glyco_trans_10. [Graphical view] |
| KO | K09669. |
| PANTHER | PTHR11929. Glyco_trans_10. 1 hit. |
| Pfam | PF00852. Glyco_transf_10. 1 hit. [Graphical view] |
| PIRSF | PIRSF037332. Alpha1_3FUT_met. 1 hit. |
| ProtoNet | Search... |
Other | |
| NextBio | 74892. |
Entry information
| Entry name | FUT10_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6P4F1 Secondary accession number(s): A8KAC8 Q9BSR3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with