Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Alpha-(1,3)-fucosyltransferase 10

Gene

FUT10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Probable fucosyltransferase.By similarity

Pathwayi: protein glycosylation

This protein is involved in the pathway protein glycosylation, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein glycosylation and in Protein modification.

GO - Molecular functioni

  • alpha-(1->3)-fucosyltransferase activity Source: UniProtKB

GO - Biological processi

  • cerebral cortex radially oriented cell migration Source: Ensembl
  • embryo development Source: UniProtKB
  • fertilization Source: UniProtKB
  • hemopoiesis Source: UniProtKB
  • L-fucose catabolic process Source: UniProtKB
  • nervous system development Source: UniProtKB
  • neuronal stem cell population maintenance Source: Ensembl
  • protein folding Source: UniProtKB
  • protein glycosylation Source: UniProtKB
  • protein N-linked glycosylation Source: GO_Central
  • protein targeting Source: UniProtKB
  • wound healing Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Glycosyltransferase, Transferase

Enzyme and pathway databases

BRENDAi2.4.1.65. 2681.
UniPathwayiUPA00378.

Protein family/group databases

CAZyiGT10. Glycosyltransferase Family 10.

Names & Taxonomyi

Protein namesi
Recommended name:
Alpha-(1,3)-fucosyltransferase 10 (EC:2.4.1.-)
Alternative name(s):
Fucosyltransferase X
Short name:
Fuc-TX
Short name:
FucT-X
Galactoside 3-L-fucosyltransferase 10
Short name:
Fucosyltransferase 10
Gene namesi
Name:FUT10
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

HGNCiHGNC:19234. FUT10.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 88CytoplasmicSequence analysis
Transmembranei9 – 3123Helical; Signal-anchor for type II membrane proteinSequence analysisAdd
BLAST
Topological domaini32 – 479448LumenalSequence analysisAdd
BLAST

GO - Cellular componenti

  • Golgi apparatus Source: UniProtKB
  • Golgi cisterna membrane Source: UniProtKB-SubCell
  • Golgi membrane Source: GO_Central
  • integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134872572.

Chemistry

ChEMBLiCHEMBL2926.

Polymorphism and mutation databases

BioMutaiFUT10.
DMDMi156630455.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 479479Alpha-(1,3)-fucosyltransferase 10PRO_0000299002Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi110 – 1101N-linked (GlcNAc...)Sequence analysis
Glycosylationi168 – 1681N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ6P4F1.
PeptideAtlasiQ6P4F1.
PRIDEiQ6P4F1.

PTM databases

iPTMnetiQ6P4F1.
PhosphoSiteiQ6P4F1.

Expressioni

Gene expression databases

BgeeiENSG00000172728.
CleanExiHS_FUT10.
GenevisibleiQ6P4F1. HS.

Organism-specific databases

HPAiHPA053970.
HPA058655.

Interactioni

Protein-protein interaction databases

BioGridi124239. 2 interactions.
STRINGi9606.ENSP00000332757.

Chemistry

BindingDBiQ6P4F1.

Structurei

3D structure databases

ProteinModelPortaliQ6P4F1.
SMRiQ6P4F1. Positions 210-394.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the glycosyltransferase 10 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2619. Eukaryota.
ENOG410ZIMX. LUCA.
GeneTreeiENSGT00680000099679.
HOVERGENiHBG055521.
InParanoidiQ6P4F1.
KOiK09669.
OMAiHKPVITL.
OrthoDBiEOG091G064Z.
PhylomeDBiQ6P4F1.
TreeFamiTF316348.

Family and domain databases

InterProiIPR017176. Alpha-1_3-FUT_met.
IPR031481. Glyco_tran_10_N.
IPR001503. Glyco_trans_10.
[Graphical view]
PANTHERiPTHR11929. PTHR11929. 1 hit.
PfamiPF17039. Glyco_tran_10_N. 1 hit.
PF00852. Glyco_transf_10. 1 hit.
[Graphical view]
PIRSFiPIRSF037332. Alpha1_3FUT_met. 1 hit.

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6P4F1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVRIQRRKLL ASCLCVTATV FLLVTLQVMV ELGKFERKEF KSSSLQDGHT
60 70 80 90 100
KMEEAPTHLN SFLKKEGLTF NRKRKWELDS YPIMLWWSPL TGETGRLGQC
110 120 130 140 150
GADACFFTIN RTYLHHHMTK AFLFYGTDFN IDSLPLPRKA HHDWAVFHEE
160 170 180 190 200
SPKNNYKLFH KPVITLFNYT ATFSRHSHLP LTTQYLESIE VLKSLRYLVP
210 220 230 240 250
LQSKNKLRKR LAPLVYVQSD CDPPSDRDSY VRELMTYIEV DSYGECLRNK
260 270 280 290 300
DLPQQLKNPA SMDADGFYRI IAQYKFILAF ENAVCDDYIT EKFWRPLKLG
310 320 330 340 350
VVPVYYGSPS ITDWLPSNKS AILVSEFSHP RELASYIRRL DSDDRLYEAY
360 370 380 390 400
VEWKLKGEIS NQRLLTALRE RKWGVQDVNQ DNYIDAFECM VCTKVWANIR
410 420 430 440 450
LQEKGLPPKR WEAEDTHLSC PEPTVFAFSP LRTPPLSSLR EMWISSFEQS
460 470
KKEAQALRWL VDRNQNFSSQ EFWGLVFKD
Length:479
Mass (Da):56,094
Last modified:August 21, 2007 - v2
Checksum:i205594E0CE587208
GO
Isoform 2 (identifier: Q6P4F1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     27-27: Q → ALDTVENLMKVTGPPQGVTDSMQCFNDQRPLSNTRSSEHIKE

Note: No experimental confirmation available.
Show »
Length:520
Mass (Da):60,623
Checksum:i28C18FA4A26AAA19
GO
Isoform 3 (identifier: Q6P4F1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-62: Missing.
     63-126: LKKEGLTFNR...HMTKAFLFYG → MGIGQLPHYA...ESPPLAENDG
     405-419: GLPPKRWEAEDTHLS → VSKSKVGIEPAGWPS
     420-479: Missing.

Show »
Length:357
Mass (Da):41,347
Checksum:iDD4F2FDF085594D8
GO
Isoform 4 (identifier: Q6P4F1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-28: Missing.
     405-419: GLPPKRWEAEDTHLS → VSKSKVGIEPAGWPS
     420-479: Missing.

Show »
Length:391
Mass (Da):45,696
Checksum:i332C1B4FCDCA45C5
GO
Isoform 5 (identifier: Q6P4F1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     405-419: GLPPKRWEAEDTHLS → VSKSKVGIEPAGWPS
     420-479: Missing.

Show »
Length:419
Mass (Da):48,854
Checksum:i6E17FF8315B553E5
GO
Isoform 6 (identifier: Q6P4F1-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-28: Missing.

Show »
Length:451
Mass (Da):52,936
Checksum:iD22DD5C22C2922A0
GO
Isoform 7 (identifier: Q6P4F1-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: Missing.
     127-143: TDFNIDSLPLPRKAHHD → KQDFRLSPLFAVVFLQS
     144-479: Missing.

Note: No experimental confirmation available.
Show »
Length:92
Mass (Da):10,819
Checksum:i10976CD2E611F582
GO

Sequence cautioni

The sequence CAD24023 differs from that shown. Reason: Erroneous initiation. Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti59 – 591L → F.1 Publication
Corresponds to variant rs16880994 [ dbSNP | Ensembl ].
VAR_034759
Natural varianti268 – 2681Y → H.
Corresponds to variant rs16880853 [ dbSNP | Ensembl ].
VAR_034760
Natural varianti368 – 3681L → V.2 Publications
Corresponds to variant rs17855838 [ dbSNP | Ensembl ].
VAR_034761
Natural varianti371 – 3711R → P.1 Publication
Corresponds to variant rs17855839 [ dbSNP | Ensembl ].
VAR_034762

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6262Missing in isoform 3. 1 PublicationVSP_027498Add
BLAST
Alternative sequencei1 – 5151Missing in isoform 7. 1 PublicationVSP_027499Add
BLAST
Alternative sequencei1 – 2828Missing in isoform 4 and isoform 6. 2 PublicationsVSP_027500Add
BLAST
Alternative sequencei27 – 271Q → ALDTVENLMKVTGPPQGVTD SMQCFNDQRPLSNTRSSEHI KE in isoform 2. 1 PublicationVSP_027501
Alternative sequencei63 – 12664LKKEG…FLFYG → MGIGQLPHYALVVPADGGDW EVRPMWSRCLFLHHQPDLPP SSHDQSIPLLWSQEESPPLA ENDG in isoform 3. 1 PublicationVSP_027502Add
BLAST
Alternative sequencei127 – 14317TDFNI…KAHHD → KQDFRLSPLFAVVFLQS in isoform 7. 1 PublicationVSP_027503Add
BLAST
Alternative sequencei144 – 479336Missing in isoform 7. 1 PublicationVSP_027504Add
BLAST
Alternative sequencei405 – 41915GLPPK…DTHLS → VSKSKVGIEPAGWPS in isoform 3, isoform 4 and isoform 5. 1 PublicationVSP_027505Add
BLAST
Alternative sequencei420 – 47960Missing in isoform 3, isoform 4 and isoform 5. 1 PublicationVSP_027506Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ431184 mRNA. Translation: CAD24023.1. Different initiation.
AJ512465 mRNA. Translation: CAD54669.1.
AJ535838 mRNA. Translation: CAD59771.1.
AJ535839 mRNA. Translation: CAD59772.1.
AJ582015 mRNA. Translation: CAE46499.1.
AK292993 mRNA. Translation: BAF85682.1.
CH471080 Genomic DNA. Translation: EAW63404.1.
BC004884 mRNA. Translation: AAH04884.2.
BC063462 mRNA. Translation: AAH63462.1.
CCDSiCCDS6088.1. [Q6P4F1-1]
RefSeqiNP_116053.3. NM_032664.3. [Q6P4F1-1]
UniGeneiHs.458713.

Genome annotation databases

EnsembliENST00000327671; ENSP00000332757; ENSG00000172728. [Q6P4F1-1]
ENST00000518672; ENSP00000430428; ENSG00000172728. [Q6P4F1-6]
ENST00000524021; ENSP00000429870; ENSG00000172728. [Q6P4F1-6]
GeneIDi84750.
KEGGihsa:84750.
UCSCiuc003xjd.4. human. [Q6P4F1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ431184 mRNA. Translation: CAD24023.1. Different initiation.
AJ512465 mRNA. Translation: CAD54669.1.
AJ535838 mRNA. Translation: CAD59771.1.
AJ535839 mRNA. Translation: CAD59772.1.
AJ582015 mRNA. Translation: CAE46499.1.
AK292993 mRNA. Translation: BAF85682.1.
CH471080 Genomic DNA. Translation: EAW63404.1.
BC004884 mRNA. Translation: AAH04884.2.
BC063462 mRNA. Translation: AAH63462.1.
CCDSiCCDS6088.1. [Q6P4F1-1]
RefSeqiNP_116053.3. NM_032664.3. [Q6P4F1-1]
UniGeneiHs.458713.

3D structure databases

ProteinModelPortaliQ6P4F1.
SMRiQ6P4F1. Positions 210-394.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124239. 2 interactions.
STRINGi9606.ENSP00000332757.

Chemistry

BindingDBiQ6P4F1.
ChEMBLiCHEMBL2926.

Protein family/group databases

CAZyiGT10. Glycosyltransferase Family 10.

PTM databases

iPTMnetiQ6P4F1.
PhosphoSiteiQ6P4F1.

Polymorphism and mutation databases

BioMutaiFUT10.
DMDMi156630455.

Proteomic databases

PaxDbiQ6P4F1.
PeptideAtlasiQ6P4F1.
PRIDEiQ6P4F1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000327671; ENSP00000332757; ENSG00000172728. [Q6P4F1-1]
ENST00000518672; ENSP00000430428; ENSG00000172728. [Q6P4F1-6]
ENST00000524021; ENSP00000429870; ENSG00000172728. [Q6P4F1-6]
GeneIDi84750.
KEGGihsa:84750.
UCSCiuc003xjd.4. human. [Q6P4F1-1]

Organism-specific databases

CTDi84750.
GeneCardsiFUT10.
HGNCiHGNC:19234. FUT10.
HPAiHPA053970.
HPA058655.
neXtProtiNX_Q6P4F1.
PharmGKBiPA134872572.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2619. Eukaryota.
ENOG410ZIMX. LUCA.
GeneTreeiENSGT00680000099679.
HOVERGENiHBG055521.
InParanoidiQ6P4F1.
KOiK09669.
OMAiHKPVITL.
OrthoDBiEOG091G064Z.
PhylomeDBiQ6P4F1.
TreeFamiTF316348.

Enzyme and pathway databases

UniPathwayiUPA00378.
BRENDAi2.4.1.65. 2681.

Miscellaneous databases

ChiTaRSiFUT10. human.
GenomeRNAii84750.
PROiQ6P4F1.

Gene expression databases

BgeeiENSG00000172728.
CleanExiHS_FUT10.
GenevisibleiQ6P4F1. HS.

Family and domain databases

InterProiIPR017176. Alpha-1_3-FUT_met.
IPR031481. Glyco_tran_10_N.
IPR001503. Glyco_trans_10.
[Graphical view]
PANTHERiPTHR11929. PTHR11929. 1 hit.
PfamiPF17039. Glyco_tran_10_N. 1 hit.
PF00852. Glyco_transf_10. 1 hit.
[Graphical view]
PIRSFiPIRSF037332. Alpha1_3FUT_met. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiFUT10_HUMAN
AccessioniPrimary (citable) accession number: Q6P4F1
Secondary accession number(s): A8KAC8
, Q70GG3, Q8IVI6, Q8IVI7, Q8IVJ3, Q8TE43, Q9BSR3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 21, 2007
Last sequence update: August 21, 2007
Last modified: September 7, 2016
This is version 104 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.