Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein FAM122C

Gene

FAM122C

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Protein FAM122C
Gene namesi
Name:FAM122C
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

HGNCiHGNC:25202. FAM122C.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA145148896.

Polymorphism and mutation databases

BioMutaiFAM122C.
DMDMi74737331.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 195195Protein FAM122CPRO_0000254547Add
BLAST

Proteomic databases

PaxDbiQ6P4D5.
PeptideAtlasiQ6P4D5.
PRIDEiQ6P4D5.

PTM databases

PhosphoSiteiQ6P4D5.

Expressioni

Gene expression databases

BgeeiENSG00000156500.
CleanExiHS_FAM122C.
ExpressionAtlasiQ6P4D5. baseline and differential.
GenevisibleiQ6P4D5. HS.

Organism-specific databases

HPAiHPA059961.

Interactioni

Protein-protein interaction databases

BioGridi127731. 1 interaction.
IntActiQ6P4D5. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ6P4D5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the FAM122 family.Curated

Phylogenomic databases

eggNOGiENOG410JBRN. Eukaryota.
ENOG4111914. LUCA.
GeneTreeiENSGT00390000015476.
HOGENOMiHOG000112463.
InParanoidiQ6P4D5.
OMAiQPTCFLL.
OrthoDBiEOG091G0EDK.
PhylomeDBiQ6P4D5.
TreeFamiTF330808.

Family and domain databases

InterProiIPR026716. FAM122.
[Graphical view]
PANTHERiPTHR22227. PTHR22227. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6P4D5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAQEKMKLGF KSLPSSTTAD GNILRRVNSA PLINGLGFNS QVLQADMLRI
60 70 80 90 100
RTNRTTFRNR RSLLLPPPPF HGSISRLHQI KQEEAMDLIN RETMSEWKLQ
110 120 130 140 150
SEIQISHSWE EGLKLVKWHF NINQKRFSKA QPTCFLLILP NCQKIMCIYF
160 170 180 190
QLLLMETTAM LDLLVIRQLK SALSQTLLCH LLILVLICSS RQTFN
Note: No experimental confirmation available.
Length:195
Mass (Da):22,522
Last modified:July 5, 2004 - v1
Checksum:i34D52D1B1601153E
GO
Isoform 2 (identifier: Q6P4D5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     116-195: VKWHFNINQK...LICSSRQTFN → NDNGLQKSSS...KTGKSTSSYF

Note: No experimental confirmation available.
Show »
Length:152
Mass (Da):17,078
Checksum:i3D5B2F8D6519CAEE
GO
Isoform 3 (identifier: Q6P4D5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAYFPGTGRTDQETQLDLSLCGREPESLENLFLDPDM
     64-79: LLPPPPFHGSISRLHQ → EITSPTSVEQKPKDLF
     80-195: Missing.

Note: No experimental confirmation available.
Show »
Length:115
Mass (Da):12,936
Checksum:i8D601D8BF6158A63
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MAYFPGTGRTDQETQLDLSL CGREPESLENLFLDPDM in isoform 3. 1 PublicationVSP_044990
Alternative sequencei64 – 7916LLPPP…SRLHQ → EITSPTSVEQKPKDLF in isoform 3. 1 PublicationVSP_044991Add
BLAST
Alternative sequencei80 – 195116Missing in isoform 3. 1 PublicationVSP_044992Add
BLAST
Alternative sequencei116 – 19580VKWHF…RQTFN → NDNGLQKSSSLKCIDLTPVS SMASSIKKTGKSTSSYF in isoform 2. 1 PublicationVSP_021222Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK307219 mRNA. No translation available.
Z83826, AL691477 Genomic DNA. Translation: CAI42827.1.
AL691477, Z83826 Genomic DNA. Translation: CAI42399.1.
BC017868 mRNA. Translation: AAH17868.1.
BC063491 mRNA. Translation: AAH63491.1.
CCDSiCCDS14644.1. [Q6P4D5-2]
CCDS55500.1. [Q6P4D5-3]
CCDS55501.1. [Q6P4D5-1]
RefSeqiNP_001164250.1. NM_001170779.1. [Q6P4D5-1]
NP_001164251.1. NM_001170780.1. [Q6P4D5-3]
NP_001164252.1. NM_001170781.1.
NP_001164254.1. NM_001170783.1.
NP_620174.1. NM_138819.3. [Q6P4D5-2]
UniGeneiHs.269127.

Genome annotation databases

EnsembliENST00000370784; ENSP00000359820; ENSG00000156500. [Q6P4D5-1]
ENST00000370785; ENSP00000359821; ENSG00000156500. [Q6P4D5-2]
ENST00000414371; ENSP00000402477; ENSG00000156500. [Q6P4D5-3]
GeneIDi159091.
KEGGihsa:159091.
UCSCiuc004exy.3. human. [Q6P4D5-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK307219 mRNA. No translation available.
Z83826, AL691477 Genomic DNA. Translation: CAI42827.1.
AL691477, Z83826 Genomic DNA. Translation: CAI42399.1.
BC017868 mRNA. Translation: AAH17868.1.
BC063491 mRNA. Translation: AAH63491.1.
CCDSiCCDS14644.1. [Q6P4D5-2]
CCDS55500.1. [Q6P4D5-3]
CCDS55501.1. [Q6P4D5-1]
RefSeqiNP_001164250.1. NM_001170779.1. [Q6P4D5-1]
NP_001164251.1. NM_001170780.1. [Q6P4D5-3]
NP_001164252.1. NM_001170781.1.
NP_001164254.1. NM_001170783.1.
NP_620174.1. NM_138819.3. [Q6P4D5-2]
UniGeneiHs.269127.

3D structure databases

ProteinModelPortaliQ6P4D5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127731. 1 interaction.
IntActiQ6P4D5. 1 interaction.

PTM databases

PhosphoSiteiQ6P4D5.

Polymorphism and mutation databases

BioMutaiFAM122C.
DMDMi74737331.

Proteomic databases

PaxDbiQ6P4D5.
PeptideAtlasiQ6P4D5.
PRIDEiQ6P4D5.

Protocols and materials databases

DNASUi159091.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000370784; ENSP00000359820; ENSG00000156500. [Q6P4D5-1]
ENST00000370785; ENSP00000359821; ENSG00000156500. [Q6P4D5-2]
ENST00000414371; ENSP00000402477; ENSG00000156500. [Q6P4D5-3]
GeneIDi159091.
KEGGihsa:159091.
UCSCiuc004exy.3. human. [Q6P4D5-1]

Organism-specific databases

CTDi159091.
GeneCardsiFAM122C.
HGNCiHGNC:25202. FAM122C.
HPAiHPA059961.
neXtProtiNX_Q6P4D5.
PharmGKBiPA145148896.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410JBRN. Eukaryota.
ENOG4111914. LUCA.
GeneTreeiENSGT00390000015476.
HOGENOMiHOG000112463.
InParanoidiQ6P4D5.
OMAiQPTCFLL.
OrthoDBiEOG091G0EDK.
PhylomeDBiQ6P4D5.
TreeFamiTF330808.

Miscellaneous databases

ChiTaRSiFAM122C. human.
GenomeRNAii159091.
PROiQ6P4D5.

Gene expression databases

BgeeiENSG00000156500.
CleanExiHS_FAM122C.
ExpressionAtlasiQ6P4D5. baseline and differential.
GenevisibleiQ6P4D5. HS.

Family and domain databases

InterProiIPR026716. FAM122.
[Graphical view]
PANTHERiPTHR22227. PTHR22227. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiF222C_HUMAN
AccessioniPrimary (citable) accession number: Q6P4D5
Secondary accession number(s): F5H036, Q8WVK9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: July 5, 2004
Last modified: September 7, 2016
This is version 85 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.