Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DnaJ homolog subfamily C member 24

Gene

DNAJC24

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Stimulates the ATPase activity of several Hsp70-type chaperones. This ability is enhanced by iron-binding. The iron-bound form is redox-active and can function as electron carrier. Plays a role in the diphthamide biosynthesis, a post-translational modification of histidine which occurs in translation elongation factor 2 (EEF2) which can be ADP-ribosylated by diphtheria toxin and by Pseudomonas exotoxin A (Eta).2 Publications

Pathwayi: peptidyl-diphthamide biosynthesis

This protein is involved in the pathway peptidyl-diphthamide biosynthesis, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway peptidyl-diphthamide biosynthesis and in Protein modification.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri92 – 147DPH-typePROSITE-ProRule annotationAdd BLAST56

GO - Molecular functioni

  • ATPase activator activity Source: UniProtKB
  • ferrous iron binding Source: UniProtKB
  • zinc ion binding Source: UniProtKB

GO - Biological processi

  • chaperone-mediated protein folding Source: UniProtKB
  • oxidation-reduction process Source: UniProtKB-KW
  • peptidyl-diphthamide biosynthetic process from peptidyl-histidine Source: UniProtKB-UniPathway
  • positive regulation of ATPase activity Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Electron transport, Transport

Keywords - Ligandi

Iron, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-5358493. Synthesis of diphthamide-EEF2.
UniPathwayiUPA00559.

Names & Taxonomyi

Protein namesi
Recommended name:
DnaJ homolog subfamily C member 24
Alternative name(s):
CSL-type zinc finger-containing protein 3
Diphthamide biosynthesis protein 4
Gene namesi
Name:DNAJC24
Synonyms:DPH4, ZCSL3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Unplaced

Organism-specific databases

HGNCiHGNC:26979. DNAJC24.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi138C → S: Loss of iron-binding. 1 Publication1

Organism-specific databases

DisGeNETi120526.
PharmGKBiPA162383906.

Polymorphism and mutation databases

BioMutaiDNAJC24.
DMDMi66773991.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000826221 – 148DnaJ homolog subfamily C member 24Add BLAST148

Proteomic databases

MaxQBiQ6P3W2.
PaxDbiQ6P3W2.
PeptideAtlasiQ6P3W2.
PRIDEiQ6P3W2.

PTM databases

iPTMnetiQ6P3W2.
PhosphoSitePlusiQ6P3W2.

Expressioni

Gene expression databases

BgeeiENSG00000170946.
CleanExiHS_DNAJC24.

Organism-specific databases

HPAiHPA020025.
HPA025237.

Interactioni

Subunit structurei

Monomer and homooligomer. Iron binding promotes oligomerization.1 Publication

Protein-protein interaction databases

BioGridi125688. 2 interactors.
STRINGi9606.ENSP00000417548.

Structurei

Secondary structure

1148
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi10 – 15Combined sources6
Helixi23 – 37Combined sources15
Helixi49 – 67Combined sources19
Beta strandi68 – 70Combined sources3
Turni71 – 74Combined sources4
Helixi76 – 87Combined sources12
Beta strandi91 – 97Combined sources7
Turni98 – 100Combined sources3
Beta strandi101 – 104Combined sources4
Turni105 – 108Combined sources4
Beta strandi109 – 113Combined sources5
Beta strandi115 – 117Combined sources3
Beta strandi119 – 123Combined sources5
Helixi126 – 129Combined sources4
Beta strandi132 – 134Combined sources3
Beta strandi136 – 139Combined sources4
Beta strandi141 – 145Combined sources5

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2L6LNMR-A1-148[»]
ProteinModelPortaliQ6P3W2.
SMRiQ6P3W2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini10 – 81JPROSITE-ProRule annotationAdd BLAST72

Domaini

The DPH-type zinc finger can also bind iron ions instead of the expected zinc ions.1 Publication

Sequence similaritiesi

Belongs to the DPH4 family.Curated
Contains 1 DPH-type zinc finger.PROSITE-ProRule annotation
Contains 1 J domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri92 – 147DPH-typePROSITE-ProRule annotationAdd BLAST56

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiKOG0715. Eukaryota.
COG0484. LUCA.
HOGENOMiHOG000189813.
HOVERGENiHBG066253.
InParanoidiQ6P3W2.
KOiK17867.
OMAiLTKEWPL.
PhylomeDBiQ6P3W2.
TreeFamiTF326955.

Family and domain databases

CDDicd06257. DnaJ. 1 hit.
Gene3Di1.10.287.110. 1 hit.
InterProiIPR001623. DnaJ_domain.
IPR007872. Znf_DHP.
[Graphical view]
PfamiPF00226. DnaJ. 1 hit.
PF05207. zf-CSL. 1 hit.
[Graphical view]
PRINTSiPR00625. JDOMAIN.
SMARTiSM00271. DnaJ. 1 hit.
[Graphical view]
SUPFAMiSSF46565. SSF46565. 1 hit.
PROSITEiPS50076. DNAJ_2. 1 hit.
PS51074. ZF_DPH. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6P3W2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAVEQMPKKD WYSILGADPS ANISDLKQKY QKLILMYHPD KQSTDVPAGT
60 70 80 90 100
VEECVQKFIE IDQAWKILGN EETKREYDLQ RCEDDLRNVG PVDAQVYLEE
110 120 130 140
MSWNEGDHSF YLSCRCGGKY SVSKDEAEEV SLISCDTCSL IIELLHYN
Length:148
Mass (Da):17,008
Last modified:July 5, 2004 - v1
Checksum:iA9A4F58BC74FECFD
GO
Isoform 2 (identifier: Q6P3W2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     83-148: EDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDTCSLIIELLHYN → GS

Note: No experimental confirmation available.
Show »
Length:84
Mass (Da):9,693
Checksum:iD14BDA3E237C1F1C
GO

Sequence cautioni

The sequence EAW68245 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03639722N → D in a breast cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_05627483 – 148EDDLR…LLHYN → GS in isoform 2. 1 PublicationAdd BLAST66

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK289665 mRNA. Translation: BAF82354.1.
AC108456 Genomic DNA. No translation available.
AL137804 Genomic DNA. No translation available.
CH471064 Genomic DNA. Translation: EAW68245.1. Different initiation.
BC036571 mRNA. Translation: AAH36571.1.
BC063804 mRNA. Translation: AAH63804.1.
RefSeqiNP_859057.4. NM_181706.4.
UniGeneiHs.187269.
Hs.741895.

Genome annotation databases

EnsembliENST00000536040; ENSP00000444967; ENSG00000170946.
GeneIDi120526.
KEGGihsa:120526.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK289665 mRNA. Translation: BAF82354.1.
AC108456 Genomic DNA. No translation available.
AL137804 Genomic DNA. No translation available.
CH471064 Genomic DNA. Translation: EAW68245.1. Different initiation.
BC036571 mRNA. Translation: AAH36571.1.
BC063804 mRNA. Translation: AAH63804.1.
RefSeqiNP_859057.4. NM_181706.4.
UniGeneiHs.187269.
Hs.741895.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2L6LNMR-A1-148[»]
ProteinModelPortaliQ6P3W2.
SMRiQ6P3W2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125688. 2 interactors.
STRINGi9606.ENSP00000417548.

PTM databases

iPTMnetiQ6P3W2.
PhosphoSitePlusiQ6P3W2.

Polymorphism and mutation databases

BioMutaiDNAJC24.
DMDMi66773991.

Proteomic databases

MaxQBiQ6P3W2.
PaxDbiQ6P3W2.
PeptideAtlasiQ6P3W2.
PRIDEiQ6P3W2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000536040; ENSP00000444967; ENSG00000170946.
GeneIDi120526.
KEGGihsa:120526.

Organism-specific databases

CTDi120526.
DisGeNETi120526.
GeneCardsiDNAJC24.
HGNCiHGNC:26979. DNAJC24.
HPAiHPA020025.
HPA025237.
MIMi611072. gene.
neXtProtiNX_Q6P3W2.
PharmGKBiPA162383906.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0715. Eukaryota.
COG0484. LUCA.
HOGENOMiHOG000189813.
HOVERGENiHBG066253.
InParanoidiQ6P3W2.
KOiK17867.
OMAiLTKEWPL.
PhylomeDBiQ6P3W2.
TreeFamiTF326955.

Enzyme and pathway databases

UniPathwayiUPA00559.
ReactomeiR-HSA-5358493. Synthesis of diphthamide-EEF2.

Miscellaneous databases

ChiTaRSiDNAJC24. human.
GenomeRNAii120526.
PROiQ6P3W2.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000170946.
CleanExiHS_DNAJC24.

Family and domain databases

CDDicd06257. DnaJ. 1 hit.
Gene3Di1.10.287.110. 1 hit.
InterProiIPR001623. DnaJ_domain.
IPR007872. Znf_DHP.
[Graphical view]
PfamiPF00226. DnaJ. 1 hit.
PF05207. zf-CSL. 1 hit.
[Graphical view]
PRINTSiPR00625. JDOMAIN.
SMARTiSM00271. DnaJ. 1 hit.
[Graphical view]
SUPFAMiSSF46565. SSF46565. 1 hit.
PROSITEiPS50076. DNAJ_2. 1 hit.
PS51074. ZF_DPH. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiDJC24_HUMAN
AccessioniPrimary (citable) accession number: Q6P3W2
Secondary accession number(s): A8K0V0, B1ALC1, I6L9B4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 24, 2005
Last sequence update: July 5, 2004
Last modified: November 2, 2016
This is version 111 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.