Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6P2H3

- CEP85_HUMAN

UniProt

Q6P2H3 - CEP85_HUMAN

Protein

Centrosomal protein of 85 kDa

Gene

CEP85

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 81 (01 Oct 2014)
      Sequence version 1 (05 Jul 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. protein binding Source: IntAct

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Centrosomal protein of 85 kDa
    Short name:
    Cep85
    Alternative name(s):
    Coiled-coil domain-containing protein 21
    Gene namesi
    Name:CEP85
    Synonyms:CCDC21
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:25309. CEP85.

    Subcellular locationi

    Cytoplasmcytoskeletonmicrotubule organizing centercentrosome 1 Publication. Cytoplasmcytoskeletonspindle pole 1 Publication. Nucleusnucleolus 1 Publication
    Note: Localizes to centrosomes and nucleolus in interphase. Upon entry into mitosis, relocates from nucleolus and accumulates at spindle poles.

    GO - Cellular componenti

    1. centrosome Source: UniProtKB
    2. cytoplasm Source: UniProtKB-KW
    3. nucleolus Source: UniProtKB
    4. spindle pole Source: UniProtKB

    Keywords - Cellular componenti

    Cytoplasm, Cytoskeleton, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142672180.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 762762Centrosomal protein of 85 kDaPRO_0000233660Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei17 – 171Phosphoserine1 Publication
    Modified residuei623 – 6231Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ6P2H3.
    PaxDbiQ6P2H3.
    PRIDEiQ6P2H3.

    PTM databases

    PhosphoSiteiQ6P2H3.

    Expressioni

    Gene expression databases

    ArrayExpressiQ6P2H3.
    BgeeiQ6P2H3.
    CleanExiHS_CCDC21.
    GenevestigatoriQ6P2H3.

    Organism-specific databases

    HPAiHPA028252.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    Q9WMX22EBI-2808308,EBI-6863741From a different organism.

    Protein-protein interaction databases

    BioGridi122301. 6 interactions.
    IntActiQ6P2H3. 14 interactions.
    MINTiMINT-7034519.
    STRINGi9606.ENSP00000252992.

    Structurei

    3D structure databases

    ProteinModelPortaliQ6P2H3.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili334 – 657324Sequence AnalysisAdd
    BLAST
    Coiled coili723 – 75028Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Belongs to the CEP85 family.Curated

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiNOG150793.
    HOVERGENiHBG058148.
    InParanoidiQ6P2H3.
    KOiK16766.
    OMAiEQSWFPA.
    OrthoDBiEOG75TMBD.
    PhylomeDBiQ6P2H3.
    TreeFamiTF331041.

    Family and domain databases

    InterProiIPR029777. Cep85.
    [Graphical view]
    PANTHERiPTHR31075:SF3. PTHR31075:SF3. 1 hit.

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6P2H3-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAMQEKYPTE GISHVTSPSS DVIQKGSSLG TEWQTPVISE PFRSRFSRCS    50
    SVADSGDTAI GTSCSDIAED FCSSSGSPPF QPIKSHVTIP TAHVMPSTLG 100
    TSPAKPNSTP VGPSSSKLPL SGLAESVGMT RNGDLGAMKH SPGLSRDLMY 150
    FSGATGENGI EQSWFPAVGH ERQEEARKFD IPSMESTLNQ SAMMETLYSD 200
    PHHRVRFHNP RTSTSKELYR VLPEAKKAPG SGAVFERNGP HSNSSGVLPL 250
    GLQPAPGLSK PLPSQVWQPS PDTWHPREQS CELSTCRQQL ELIRLQMEQM 300
    QLQNGAICHH PAAFGPSLPI LEPAQWISIL NSNEHLLKEK ELLIDKQRKH 350
    ISQLEQKVRE SELQVHSALL GRPAPFGDVC LLRLQELQRE NTFLRAQFAQ 400
    KTEALSREKI DLEKKLSASE VEVQLIRESL KVALQKHSEE VKKQEERVKG 450
    RDKHINNLKK KCQKESEQNR EKQQRIETLE RYLADLPTLE DHQKQSQQLK 500
    DSELKSTELQ EKVTELESLL EETQAICREK EIQLESLRQR EAEFSSAGHS 550
    LQDKQSVEET SGEGPEVEME SWQKRYDSLQ KIVEKQQQKM DQLRSQVQSL 600
    EQEVAQEEGT SQALREEAQR RDSALQQLRT AVKELSVQNQ DLIEKNLTLQ 650
    EHLRQAQPGS PPSPDTAQLA LELHQELASC LQDLQAVCSI VTQRAQGHDP 700
    NLSLLLGIHS AQHPETQLDL QKPDVIKRKL EEVQQLRRDI EDLRTTMSDR 750
    YAQDMGENCV TQ 762
    Length:762
    Mass (Da):85,639
    Last modified:July 5, 2004 - v1
    Checksum:iE6003FD530D8ACA8
    GO
    Isoform 2 (identifier: Q6P2H3-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         710-711: SA → S

    Show »
    Length:761
    Mass (Da):85,568
    Checksum:i0B8AC50D8C8EFC4E
    GO
    Isoform 3 (identifier: Q6P2H3-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-568: Missing.

    Show »
    Length:194
    Mass (Da):22,242
    Checksum:i7835587B0D08A905
    GO
    Isoform 4 (identifier: Q6P2H3-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         19-70: SSDVIQKGSSLGTEWQTPVISEPFRSRFSRCSSVADSGDTAIGTSCSDIAED → N

    Show »
    Length:711
    Mass (Da):80,302
    Checksum:iE6C1B3A216E4D094
    GO

    Sequence cautioni

    The sequence BAB15203.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti258 – 2603LSK → HSSQ in BAB14794. (PubMed:14702039)Curated
    Sequence conflicti517 – 5171E → G in BAG61323. (PubMed:14702039)Curated
    Sequence conflicti561 – 5611S → G in BAB15203. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti48 – 481R → H.
    Corresponds to variant rs35831900 [ dbSNP | Ensembl ].
    VAR_053938
    Natural varianti213 – 2131S → N.
    Corresponds to variant rs3795686 [ dbSNP | Ensembl ].
    VAR_053939
    Natural varianti542 – 5421A → T.
    Corresponds to variant rs7550997 [ dbSNP | Ensembl ].
    VAR_033665
    Natural varianti668 – 6681Q → H.
    Corresponds to variant rs36013141 [ dbSNP | Ensembl ].
    VAR_053940

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 568568Missing in isoform 3. 1 PublicationVSP_026435Add
    BLAST
    Alternative sequencei19 – 7052SSDVI…DIAED → N in isoform 4. 1 PublicationVSP_055609Add
    BLAST
    Alternative sequencei710 – 7112SA → S in isoform 2. 2 PublicationsVSP_018147

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK024038 mRNA. Translation: BAB14794.1.
    AK025653 mRNA. Translation: BAB15203.1. Different initiation.
    AK299312 mRNA. Translation: BAG61323.1.
    AL355877 Genomic DNA. No translation available.
    AL451139 Genomic DNA. No translation available.
    CH471059 Genomic DNA. Translation: EAX07834.1.
    CH471059 Genomic DNA. Translation: EAX07835.1.
    BC019902 mRNA. Translation: AAH19902.1.
    BC064528 mRNA. Translation: AAH64528.1.
    AL133609 mRNA. Translation: CAB63740.1.
    CCDSiCCDS277.1. [Q6P2H3-1]
    PIRiT43448.
    RefSeqiNP_001268446.1. NM_001281517.1.
    NP_001268447.1. NM_001281518.1. [Q6P2H3-3]
    NP_073615.2. NM_022778.3. [Q6P2H3-1]
    XP_005246026.1. XM_005245969.1. [Q6P2H3-2]
    XP_006710885.1. XM_006710822.1. [Q6P2H3-1]
    XP_006710886.1. XM_006710823.1. [Q6P2H3-1]
    UniGeneiHs.109051.
    Hs.63795.

    Genome annotation databases

    EnsembliENST00000252992; ENSP00000252992; ENSG00000130695. [Q6P2H3-1]
    ENST00000451429; ENSP00000417002; ENSG00000130695. [Q6P2H3-4]
    ENST00000476272; ENSP00000432354; ENSG00000130695. [Q6P2H3-2]
    GeneIDi64793.
    KEGGihsa:64793.
    UCSCiuc001blr.3. human. [Q6P2H3-2]
    uc001bls.1. human. [Q6P2H3-1]
    uc001blt.1. human. [Q6P2H3-3]

    Polymorphism databases

    DMDMi74737212.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK024038 mRNA. Translation: BAB14794.1 .
    AK025653 mRNA. Translation: BAB15203.1 . Different initiation.
    AK299312 mRNA. Translation: BAG61323.1 .
    AL355877 Genomic DNA. No translation available.
    AL451139 Genomic DNA. No translation available.
    CH471059 Genomic DNA. Translation: EAX07834.1 .
    CH471059 Genomic DNA. Translation: EAX07835.1 .
    BC019902 mRNA. Translation: AAH19902.1 .
    BC064528 mRNA. Translation: AAH64528.1 .
    AL133609 mRNA. Translation: CAB63740.1 .
    CCDSi CCDS277.1. [Q6P2H3-1 ]
    PIRi T43448.
    RefSeqi NP_001268446.1. NM_001281517.1.
    NP_001268447.1. NM_001281518.1. [Q6P2H3-3 ]
    NP_073615.2. NM_022778.3. [Q6P2H3-1 ]
    XP_005246026.1. XM_005245969.1. [Q6P2H3-2 ]
    XP_006710885.1. XM_006710822.1. [Q6P2H3-1 ]
    XP_006710886.1. XM_006710823.1. [Q6P2H3-1 ]
    UniGenei Hs.109051.
    Hs.63795.

    3D structure databases

    ProteinModelPortali Q6P2H3.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 122301. 6 interactions.
    IntActi Q6P2H3. 14 interactions.
    MINTi MINT-7034519.
    STRINGi 9606.ENSP00000252992.

    PTM databases

    PhosphoSitei Q6P2H3.

    Polymorphism databases

    DMDMi 74737212.

    Proteomic databases

    MaxQBi Q6P2H3.
    PaxDbi Q6P2H3.
    PRIDEi Q6P2H3.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000252992 ; ENSP00000252992 ; ENSG00000130695 . [Q6P2H3-1 ]
    ENST00000451429 ; ENSP00000417002 ; ENSG00000130695 . [Q6P2H3-4 ]
    ENST00000476272 ; ENSP00000432354 ; ENSG00000130695 . [Q6P2H3-2 ]
    GeneIDi 64793.
    KEGGi hsa:64793.
    UCSCi uc001blr.3. human. [Q6P2H3-2 ]
    uc001bls.1. human. [Q6P2H3-1 ]
    uc001blt.1. human. [Q6P2H3-3 ]

    Organism-specific databases

    CTDi 64793.
    GeneCardsi GC01P026561.
    HGNCi HGNC:25309. CEP85.
    HPAi HPA028252.
    neXtProti NX_Q6P2H3.
    PharmGKBi PA142672180.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG150793.
    HOVERGENi HBG058148.
    InParanoidi Q6P2H3.
    KOi K16766.
    OMAi EQSWFPA.
    OrthoDBi EOG75TMBD.
    PhylomeDBi Q6P2H3.
    TreeFami TF331041.

    Miscellaneous databases

    GenomeRNAii 64793.
    NextBioi 66858.
    PROi Q6P2H3.

    Gene expression databases

    ArrayExpressi Q6P2H3.
    Bgeei Q6P2H3.
    CleanExi HS_CCDC21.
    Genevestigatori Q6P2H3.

    Family and domain databases

    InterProi IPR029777. Cep85.
    [Graphical view ]
    PANTHERi PTHR31075:SF3. PTHR31075:SF3. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 408-762 (ISOFORM 1).
      Tissue: Hepatoma, Retinoblastoma and Teratocarcinoma.
    2. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
      Tissue: Placenta and Testis.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 328-762 (ISOFORM 2).
      Tissue: Testis.
    6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-17, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    7. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-623, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. "Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods."
      Jakobsen L., Vanselow K., Skogs M., Toyoda Y., Lundberg E., Poser I., Falkenby L.G., Bennetzen M., Westendorf J., Nigg E.A., Uhlen M., Hyman A.A., Andersen J.S.
      EMBO J. 30:1520-1535(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY, SUBCELLULAR LOCATION.

    Entry informationi

    Entry nameiCEP85_HUMAN
    AccessioniPrimary (citable) accession number: Q6P2H3
    Secondary accession number(s): B4DRL1
    , D3DPK4, F8W7K4, Q5VY68, Q5VY70, Q9H6Q1, Q9H828, Q9UF52
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 2, 2006
    Last sequence update: July 5, 2004
    Last modified: October 1, 2014
    This is version 81 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3