Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Centrosomal protein of 85 kDa

Gene

CEP85

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Centrosomal protein of 85 kDa
Short name:
Cep85
Alternative name(s):
Coiled-coil domain-containing protein 21
Gene namesi
Name:CEP85
Synonyms:CCDC21
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:25309. CEP85.

Subcellular locationi

GO - Cellular componenti

  • centrosome Source: UniProtKB
  • cytoplasm Source: HPA
  • Golgi apparatus Source: HPA
  • nucleolus Source: UniProtKB
  • spindle pole Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142672180.

Polymorphism and mutation databases

BioMutaiCEP85.
DMDMi74737212.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 762762Centrosomal protein of 85 kDaPRO_0000233660Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei17 – 171Phosphoserine1 Publication
Modified residuei623 – 6231Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ6P2H3.
PaxDbiQ6P2H3.
PRIDEiQ6P2H3.

PTM databases

PhosphoSiteiQ6P2H3.

Expressioni

Gene expression databases

BgeeiQ6P2H3.
CleanExiHS_CCDC21.
ExpressionAtlasiQ6P2H3. baseline and differential.
GenevisibleiQ6P2H3. HS.

Organism-specific databases

HPAiHPA028252.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
Q9WMX22EBI-2808308,EBI-6863741From a different organism.

Protein-protein interaction databases

BioGridi122301. 13 interactions.
IntActiQ6P2H3. 18 interactions.
MINTiMINT-7034519.
STRINGi9606.ENSP00000252992.

Structurei

3D structure databases

ProteinModelPortaliQ6P2H3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili334 – 657324Sequence AnalysisAdd
BLAST
Coiled coili723 – 75028Sequence AnalysisAdd
BLAST

Sequence similaritiesi

Belongs to the CEP85 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG150793.
GeneTreeiENSGT00620000087993.
HOVERGENiHBG058148.
InParanoidiQ6P2H3.
KOiK16766.
OMAiEQSWFPA.
OrthoDBiEOG75TMBD.
PhylomeDBiQ6P2H3.
TreeFamiTF331041.

Family and domain databases

InterProiIPR029777. Cep85.
[Graphical view]
PANTHERiPTHR31075:SF3. PTHR31075:SF3. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6P2H3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAMQEKYPTE GISHVTSPSS DVIQKGSSLG TEWQTPVISE PFRSRFSRCS
60 70 80 90 100
SVADSGDTAI GTSCSDIAED FCSSSGSPPF QPIKSHVTIP TAHVMPSTLG
110 120 130 140 150
TSPAKPNSTP VGPSSSKLPL SGLAESVGMT RNGDLGAMKH SPGLSRDLMY
160 170 180 190 200
FSGATGENGI EQSWFPAVGH ERQEEARKFD IPSMESTLNQ SAMMETLYSD
210 220 230 240 250
PHHRVRFHNP RTSTSKELYR VLPEAKKAPG SGAVFERNGP HSNSSGVLPL
260 270 280 290 300
GLQPAPGLSK PLPSQVWQPS PDTWHPREQS CELSTCRQQL ELIRLQMEQM
310 320 330 340 350
QLQNGAICHH PAAFGPSLPI LEPAQWISIL NSNEHLLKEK ELLIDKQRKH
360 370 380 390 400
ISQLEQKVRE SELQVHSALL GRPAPFGDVC LLRLQELQRE NTFLRAQFAQ
410 420 430 440 450
KTEALSREKI DLEKKLSASE VEVQLIRESL KVALQKHSEE VKKQEERVKG
460 470 480 490 500
RDKHINNLKK KCQKESEQNR EKQQRIETLE RYLADLPTLE DHQKQSQQLK
510 520 530 540 550
DSELKSTELQ EKVTELESLL EETQAICREK EIQLESLRQR EAEFSSAGHS
560 570 580 590 600
LQDKQSVEET SGEGPEVEME SWQKRYDSLQ KIVEKQQQKM DQLRSQVQSL
610 620 630 640 650
EQEVAQEEGT SQALREEAQR RDSALQQLRT AVKELSVQNQ DLIEKNLTLQ
660 670 680 690 700
EHLRQAQPGS PPSPDTAQLA LELHQELASC LQDLQAVCSI VTQRAQGHDP
710 720 730 740 750
NLSLLLGIHS AQHPETQLDL QKPDVIKRKL EEVQQLRRDI EDLRTTMSDR
760
YAQDMGENCV TQ
Length:762
Mass (Da):85,639
Last modified:July 5, 2004 - v1
Checksum:iE6003FD530D8ACA8
GO
Isoform 2 (identifier: Q6P2H3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     710-711: SA → S

Show »
Length:761
Mass (Da):85,568
Checksum:i0B8AC50D8C8EFC4E
GO
Isoform 3 (identifier: Q6P2H3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-568: Missing.

Show »
Length:194
Mass (Da):22,242
Checksum:i7835587B0D08A905
GO
Isoform 4 (identifier: Q6P2H3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     19-70: SSDVIQKGSSLGTEWQTPVISEPFRSRFSRCSSVADSGDTAIGTSCSDIAED → N

Show »
Length:711
Mass (Da):80,302
Checksum:iE6C1B3A216E4D094
GO

Sequence cautioni

The sequence BAB15203.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti258 – 2603LSK → HSSQ in BAB14794 (PubMed:14702039).Curated
Sequence conflicti517 – 5171E → G in BAG61323 (PubMed:14702039).Curated
Sequence conflicti561 – 5611S → G in BAB15203 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti48 – 481R → H.
Corresponds to variant rs35831900 [ dbSNP | Ensembl ].
VAR_053938
Natural varianti213 – 2131S → N.
Corresponds to variant rs3795686 [ dbSNP | Ensembl ].
VAR_053939
Natural varianti542 – 5421A → T.
Corresponds to variant rs7550997 [ dbSNP | Ensembl ].
VAR_033665
Natural varianti668 – 6681Q → H.
Corresponds to variant rs36013141 [ dbSNP | Ensembl ].
VAR_053940

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 568568Missing in isoform 3. 1 PublicationVSP_026435Add
BLAST
Alternative sequencei19 – 7052SSDVI…DIAED → N in isoform 4. 1 PublicationVSP_055609Add
BLAST
Alternative sequencei710 – 7112SA → S in isoform 2. 2 PublicationsVSP_018147

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024038 mRNA. Translation: BAB14794.1.
AK025653 mRNA. Translation: BAB15203.1. Different initiation.
AK299312 mRNA. Translation: BAG61323.1.
AL355877 Genomic DNA. No translation available.
AL451139 Genomic DNA. No translation available.
CH471059 Genomic DNA. Translation: EAX07834.1.
CH471059 Genomic DNA. Translation: EAX07835.1.
BC019902 mRNA. Translation: AAH19902.1.
BC064528 mRNA. Translation: AAH64528.1.
AL133609 mRNA. Translation: CAB63740.1.
CCDSiCCDS277.1. [Q6P2H3-1]
CCDS60038.1. [Q6P2H3-4]
PIRiT43448.
RefSeqiNP_001268446.1. NM_001281517.1. [Q6P2H3-4]
NP_001268447.1. NM_001281518.1. [Q6P2H3-3]
NP_073615.2. NM_022778.3. [Q6P2H3-1]
XP_005246026.1. XM_005245969.2. [Q6P2H3-2]
UniGeneiHs.109051.
Hs.63795.

Genome annotation databases

EnsembliENST00000252992; ENSP00000252992; ENSG00000130695. [Q6P2H3-1]
ENST00000451429; ENSP00000417002; ENSG00000130695. [Q6P2H3-4]
ENST00000476272; ENSP00000432354; ENSG00000130695. [Q6P2H3-2]
GeneIDi64793.
KEGGihsa:64793.
UCSCiuc001blr.3. human. [Q6P2H3-2]
uc001bls.1. human. [Q6P2H3-1]
uc001blt.1. human. [Q6P2H3-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024038 mRNA. Translation: BAB14794.1.
AK025653 mRNA. Translation: BAB15203.1. Different initiation.
AK299312 mRNA. Translation: BAG61323.1.
AL355877 Genomic DNA. No translation available.
AL451139 Genomic DNA. No translation available.
CH471059 Genomic DNA. Translation: EAX07834.1.
CH471059 Genomic DNA. Translation: EAX07835.1.
BC019902 mRNA. Translation: AAH19902.1.
BC064528 mRNA. Translation: AAH64528.1.
AL133609 mRNA. Translation: CAB63740.1.
CCDSiCCDS277.1. [Q6P2H3-1]
CCDS60038.1. [Q6P2H3-4]
PIRiT43448.
RefSeqiNP_001268446.1. NM_001281517.1. [Q6P2H3-4]
NP_001268447.1. NM_001281518.1. [Q6P2H3-3]
NP_073615.2. NM_022778.3. [Q6P2H3-1]
XP_005246026.1. XM_005245969.2. [Q6P2H3-2]
UniGeneiHs.109051.
Hs.63795.

3D structure databases

ProteinModelPortaliQ6P2H3.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122301. 13 interactions.
IntActiQ6P2H3. 18 interactions.
MINTiMINT-7034519.
STRINGi9606.ENSP00000252992.

PTM databases

PhosphoSiteiQ6P2H3.

Polymorphism and mutation databases

BioMutaiCEP85.
DMDMi74737212.

Proteomic databases

MaxQBiQ6P2H3.
PaxDbiQ6P2H3.
PRIDEiQ6P2H3.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000252992; ENSP00000252992; ENSG00000130695. [Q6P2H3-1]
ENST00000451429; ENSP00000417002; ENSG00000130695. [Q6P2H3-4]
ENST00000476272; ENSP00000432354; ENSG00000130695. [Q6P2H3-2]
GeneIDi64793.
KEGGihsa:64793.
UCSCiuc001blr.3. human. [Q6P2H3-2]
uc001bls.1. human. [Q6P2H3-1]
uc001blt.1. human. [Q6P2H3-3]

Organism-specific databases

CTDi64793.
GeneCardsiGC01P026561.
HGNCiHGNC:25309. CEP85.
HPAiHPA028252.
neXtProtiNX_Q6P2H3.
PharmGKBiPA142672180.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG150793.
GeneTreeiENSGT00620000087993.
HOVERGENiHBG058148.
InParanoidiQ6P2H3.
KOiK16766.
OMAiEQSWFPA.
OrthoDBiEOG75TMBD.
PhylomeDBiQ6P2H3.
TreeFamiTF331041.

Miscellaneous databases

GenomeRNAii64793.
NextBioi35474413.
PROiQ6P2H3.

Gene expression databases

BgeeiQ6P2H3.
CleanExiHS_CCDC21.
ExpressionAtlasiQ6P2H3. baseline and differential.
GenevisibleiQ6P2H3. HS.

Family and domain databases

InterProiIPR029777. Cep85.
[Graphical view]
PANTHERiPTHR31075:SF3. PTHR31075:SF3. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 408-762 (ISOFORM 1).
    Tissue: Hepatoma, Retinoblastoma and Teratocarcinoma.
  2. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: Placenta and Testis.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 328-762 (ISOFORM 2).
    Tissue: Testis.
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-17, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-623, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. "Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods."
    Jakobsen L., Vanselow K., Skogs M., Toyoda Y., Lundberg E., Poser I., Falkenby L.G., Bennetzen M., Westendorf J., Nigg E.A., Uhlen M., Hyman A.A., Andersen J.S.
    EMBO J. 30:1520-1535(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY, SUBCELLULAR LOCATION.

Entry informationi

Entry nameiCEP85_HUMAN
AccessioniPrimary (citable) accession number: Q6P2H3
Secondary accession number(s): B4DRL1
, D3DPK4, F8W7K4, Q5VY68, Q5VY70, Q9H6Q1, Q9H828, Q9UF52
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 2, 2006
Last sequence update: July 5, 2004
Last modified: June 24, 2015
This is version 88 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.