Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Centrosomal protein of 85 kDa

Gene

CEP85

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acts as a negative regulator of NEK2 to maintain the centrosome integrity in interphase. Suppresses centrosome disjunction by inhibiting NEK2 kinase activity (PubMed:26220856).1 Publication

GO - Biological processi

  • chromosome segregation Source: UniProtKB-KW
  • negative regulation of protein kinase activity Source: UniProtKB
  • regulation of mitotic centrosome separation Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Chromosome partition

Names & Taxonomyi

Protein namesi
Recommended name:
Centrosomal protein of 85 kDa
Short name:
Cep85
Alternative name(s):
Coiled-coil domain-containing protein 21
Gene namesi
Name:CEP85
Synonyms:CCDC21
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:25309. CEP85.

Subcellular locationi

GO - Cellular componenti

  • centrosome Source: UniProtKB
  • cytoplasm Source: HPA
  • Golgi apparatus Source: HPA
  • nucleolus Source: UniProtKB
  • pericentriolar material Source: UniProtKB
  • spindle pole Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142672180.

Polymorphism and mutation databases

BioMutaiCEP85.
DMDMi74737212.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 762762Centrosomal protein of 85 kDaPRO_0000233660Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei17 – 171PhosphoserineCombined sources
Modified residuei126 – 1261PhosphoserineCombined sources
Modified residuei141 – 1411PhosphoserineCombined sources
Modified residuei623 – 6231PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ6P2H3.
MaxQBiQ6P2H3.
PaxDbiQ6P2H3.
PeptideAtlasiQ6P2H3.
PRIDEiQ6P2H3.

PTM databases

iPTMnetiQ6P2H3.
PhosphoSiteiQ6P2H3.

Expressioni

Gene expression databases

BgeeiENSG00000130695.
CleanExiHS_CCDC21.
ExpressionAtlasiQ6P2H3. baseline and differential.
GenevisibleiQ6P2H3. HS.

Organism-specific databases

HPAiHPA028252.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
Q9WMX22EBI-2808308,EBI-6863741From a different organism.
TERF1P542742EBI-2808308,EBI-710997

Protein-protein interaction databases

BioGridi122301. 38 interactions.
IntActiQ6P2H3. 40 interactions.
MINTiMINT-7034519.
STRINGi9606.ENSP00000252992.

Structurei

3D structure databases

ProteinModelPortaliQ6P2H3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni257 – 433177Mediates interaction with NEK2 and is required for its function in the suppression of centrosome disjunction1 PublicationAdd
BLAST
Regioni434 – 47643Required for centrosome localization and for its function in the suppression of centrosome disjunction1 PublicationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili334 – 657324Sequence analysisAdd
BLAST
Coiled coili723 – 75028Sequence analysisAdd
BLAST

Sequence similaritiesi

Belongs to the CEP85 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IGFN. Eukaryota.
ENOG410ZR9W. LUCA.
GeneTreeiENSGT00620000087993.
HOVERGENiHBG058148.
InParanoidiQ6P2H3.
KOiK16766.
OMAiEQSWFPA.
OrthoDBiEOG091G02HO.
PhylomeDBiQ6P2H3.
TreeFamiTF331041.

Family and domain databases

InterProiIPR029777. Cep85.
[Graphical view]
PANTHERiPTHR31075:SF3. PTHR31075:SF3. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6P2H3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAMQEKYPTE GISHVTSPSS DVIQKGSSLG TEWQTPVISE PFRSRFSRCS
60 70 80 90 100
SVADSGDTAI GTSCSDIAED FCSSSGSPPF QPIKSHVTIP TAHVMPSTLG
110 120 130 140 150
TSPAKPNSTP VGPSSSKLPL SGLAESVGMT RNGDLGAMKH SPGLSRDLMY
160 170 180 190 200
FSGATGENGI EQSWFPAVGH ERQEEARKFD IPSMESTLNQ SAMMETLYSD
210 220 230 240 250
PHHRVRFHNP RTSTSKELYR VLPEAKKAPG SGAVFERNGP HSNSSGVLPL
260 270 280 290 300
GLQPAPGLSK PLPSQVWQPS PDTWHPREQS CELSTCRQQL ELIRLQMEQM
310 320 330 340 350
QLQNGAICHH PAAFGPSLPI LEPAQWISIL NSNEHLLKEK ELLIDKQRKH
360 370 380 390 400
ISQLEQKVRE SELQVHSALL GRPAPFGDVC LLRLQELQRE NTFLRAQFAQ
410 420 430 440 450
KTEALSREKI DLEKKLSASE VEVQLIRESL KVALQKHSEE VKKQEERVKG
460 470 480 490 500
RDKHINNLKK KCQKESEQNR EKQQRIETLE RYLADLPTLE DHQKQSQQLK
510 520 530 540 550
DSELKSTELQ EKVTELESLL EETQAICREK EIQLESLRQR EAEFSSAGHS
560 570 580 590 600
LQDKQSVEET SGEGPEVEME SWQKRYDSLQ KIVEKQQQKM DQLRSQVQSL
610 620 630 640 650
EQEVAQEEGT SQALREEAQR RDSALQQLRT AVKELSVQNQ DLIEKNLTLQ
660 670 680 690 700
EHLRQAQPGS PPSPDTAQLA LELHQELASC LQDLQAVCSI VTQRAQGHDP
710 720 730 740 750
NLSLLLGIHS AQHPETQLDL QKPDVIKRKL EEVQQLRRDI EDLRTTMSDR
760
YAQDMGENCV TQ
Length:762
Mass (Da):85,639
Last modified:July 5, 2004 - v1
Checksum:iE6003FD530D8ACA8
GO
Isoform 2 (identifier: Q6P2H3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     710-711: SA → S

Show »
Length:761
Mass (Da):85,568
Checksum:i0B8AC50D8C8EFC4E
GO
Isoform 3 (identifier: Q6P2H3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-568: Missing.

Show »
Length:194
Mass (Da):22,242
Checksum:i7835587B0D08A905
GO
Isoform 4 (identifier: Q6P2H3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     19-70: SSDVIQKGSSLGTEWQTPVISEPFRSRFSRCSSVADSGDTAIGTSCSDIAED → N

Show »
Length:711
Mass (Da):80,302
Checksum:iE6C1B3A216E4D094
GO

Sequence cautioni

The sequence BAB15203 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti258 – 2603LSK → HSSQ in BAB14794 (PubMed:14702039).Curated
Sequence conflicti517 – 5171E → G in BAG61323 (PubMed:14702039).Curated
Sequence conflicti561 – 5611S → G in BAB15203 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti48 – 481R → H.
Corresponds to variant rs35831900 [ dbSNP | Ensembl ].
VAR_053938
Natural varianti213 – 2131S → N.
Corresponds to variant rs3795686 [ dbSNP | Ensembl ].
VAR_053939
Natural varianti542 – 5421A → T.
Corresponds to variant rs7550997 [ dbSNP | Ensembl ].
VAR_033665
Natural varianti668 – 6681Q → H.
Corresponds to variant rs36013141 [ dbSNP | Ensembl ].
VAR_053940

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 568568Missing in isoform 3. 1 PublicationVSP_026435Add
BLAST
Alternative sequencei19 – 7052SSDVI…DIAED → N in isoform 4. 1 PublicationVSP_055609Add
BLAST
Alternative sequencei710 – 7112SA → S in isoform 2. 2 PublicationsVSP_018147

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024038 mRNA. Translation: BAB14794.1.
AK025653 mRNA. Translation: BAB15203.1. Different initiation.
AK299312 mRNA. Translation: BAG61323.1.
AL355877 Genomic DNA. No translation available.
AL451139 Genomic DNA. No translation available.
CH471059 Genomic DNA. Translation: EAX07834.1.
CH471059 Genomic DNA. Translation: EAX07835.1.
BC019902 mRNA. Translation: AAH19902.1.
BC064528 mRNA. Translation: AAH64528.1.
AL133609 mRNA. Translation: CAB63740.1.
CCDSiCCDS277.1. [Q6P2H3-1]
CCDS60038.1. [Q6P2H3-4]
PIRiT43448.
RefSeqiNP_001268446.1. NM_001281517.2. [Q6P2H3-4]
NP_001268447.1. NM_001281518.2. [Q6P2H3-3]
NP_001306873.1. NM_001319944.1. [Q6P2H3-2]
NP_073615.2. NM_022778.4. [Q6P2H3-1]
UniGeneiHs.109051.
Hs.63795.

Genome annotation databases

EnsembliENST00000252992; ENSP00000252992; ENSG00000130695. [Q6P2H3-1]
ENST00000451429; ENSP00000417002; ENSG00000130695. [Q6P2H3-4]
ENST00000476272; ENSP00000432354; ENSG00000130695. [Q6P2H3-2]
GeneIDi64793.
KEGGihsa:64793.
UCSCiuc001bls.3. human. [Q6P2H3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024038 mRNA. Translation: BAB14794.1.
AK025653 mRNA. Translation: BAB15203.1. Different initiation.
AK299312 mRNA. Translation: BAG61323.1.
AL355877 Genomic DNA. No translation available.
AL451139 Genomic DNA. No translation available.
CH471059 Genomic DNA. Translation: EAX07834.1.
CH471059 Genomic DNA. Translation: EAX07835.1.
BC019902 mRNA. Translation: AAH19902.1.
BC064528 mRNA. Translation: AAH64528.1.
AL133609 mRNA. Translation: CAB63740.1.
CCDSiCCDS277.1. [Q6P2H3-1]
CCDS60038.1. [Q6P2H3-4]
PIRiT43448.
RefSeqiNP_001268446.1. NM_001281517.2. [Q6P2H3-4]
NP_001268447.1. NM_001281518.2. [Q6P2H3-3]
NP_001306873.1. NM_001319944.1. [Q6P2H3-2]
NP_073615.2. NM_022778.4. [Q6P2H3-1]
UniGeneiHs.109051.
Hs.63795.

3D structure databases

ProteinModelPortaliQ6P2H3.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122301. 38 interactions.
IntActiQ6P2H3. 40 interactions.
MINTiMINT-7034519.
STRINGi9606.ENSP00000252992.

PTM databases

iPTMnetiQ6P2H3.
PhosphoSiteiQ6P2H3.

Polymorphism and mutation databases

BioMutaiCEP85.
DMDMi74737212.

Proteomic databases

EPDiQ6P2H3.
MaxQBiQ6P2H3.
PaxDbiQ6P2H3.
PeptideAtlasiQ6P2H3.
PRIDEiQ6P2H3.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000252992; ENSP00000252992; ENSG00000130695. [Q6P2H3-1]
ENST00000451429; ENSP00000417002; ENSG00000130695. [Q6P2H3-4]
ENST00000476272; ENSP00000432354; ENSG00000130695. [Q6P2H3-2]
GeneIDi64793.
KEGGihsa:64793.
UCSCiuc001bls.3. human. [Q6P2H3-1]

Organism-specific databases

CTDi64793.
GeneCardsiCEP85.
HGNCiHGNC:25309. CEP85.
HPAiHPA028252.
neXtProtiNX_Q6P2H3.
PharmGKBiPA142672180.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IGFN. Eukaryota.
ENOG410ZR9W. LUCA.
GeneTreeiENSGT00620000087993.
HOVERGENiHBG058148.
InParanoidiQ6P2H3.
KOiK16766.
OMAiEQSWFPA.
OrthoDBiEOG091G02HO.
PhylomeDBiQ6P2H3.
TreeFamiTF331041.

Miscellaneous databases

GenomeRNAii64793.
PROiQ6P2H3.

Gene expression databases

BgeeiENSG00000130695.
CleanExiHS_CCDC21.
ExpressionAtlasiQ6P2H3. baseline and differential.
GenevisibleiQ6P2H3. HS.

Family and domain databases

InterProiIPR029777. Cep85.
[Graphical view]
PANTHERiPTHR31075:SF3. PTHR31075:SF3. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiCEP85_HUMAN
AccessioniPrimary (citable) accession number: Q6P2H3
Secondary accession number(s): B4DRL1
, D3DPK4, F8W7K4, Q5VY68, Q5VY70, Q9H6Q1, Q9H828, Q9UF52
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 2, 2006
Last sequence update: July 5, 2004
Last modified: September 7, 2016
This is version 101 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.