Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transportin-3

Gene

Tnpo3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Seems to function in nuclear protein import as nuclear transport receptor. In vitro, mediates the nuclear import of splicing factor SR proteins RBM4, SFRS1 and SFRS2, by recognizing phosphorylated RS domains (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Protein transport, Transport

Names & Taxonomyi

Protein namesi
Recommended name:
Transportin-3
Gene namesi
Name:Tnpo3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 6

Organism-specific databases

MGIiMGI:1196412. Tnpo3.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 923923Transportin-3PRO_0000120782Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionineBy similarity
Modified residuei74 – 741PhosphoserineBy similarity
Modified residuei896 – 8961PhosphothreonineBy similarity
Isoform 3 (identifier: Q6P2B1-3)
Modified residuei242 – 2421PhosphothreonineCombined sources

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ6P2B1.
MaxQBiQ6P2B1.
PaxDbiQ6P2B1.
PeptideAtlasiQ6P2B1.
PRIDEiQ6P2B1.

PTM databases

iPTMnetiQ6P2B1.
PhosphoSiteiQ6P2B1.
SwissPalmiQ6P2B1.

Expressioni

Gene expression databases

BgeeiENSMUSG00000012535.
CleanExiMM_TNPO3.
ExpressionAtlasiQ6P2B1. baseline and differential.
GenevisibleiQ6P2B1. MM.

Interactioni

Subunit structurei

Interacts with phosphorylated SFRS1 and SFRS2. Interacts with NUP62 and RBM4 (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi236407. 2 interactions.
STRINGi10090.ENSMUSP00000012679.

Structurei

3D structure databases

ProteinModelPortaliQ6P2B1.
SMRiQ6P2B1. Positions 4-923.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiKOG2081. Eukaryota.
ENOG410XRKT. LUCA.
GeneTreeiENSGT00530000063347.
HOGENOMiHOG000273876.
HOVERGENiHBG057505.
InParanoidiQ6P2B1.
KOiK15436.
OMAiIKVFRCL.
OrthoDBiEOG091G030R.
PhylomeDBiQ6P2B1.
TreeFamiTF314539.

Family and domain databases

Gene3Di1.25.10.10. 3 hits.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR013598. Exportin-1/Importin-b-like.
[Graphical view]
PfamiPF08389. Xpo1. 1 hit.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 3 hits.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6P2B1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEGAKPTLQL VYQAVQALYH DPDPSGKERA SFWLGELQRS VHAWEISDQL
60 70 80 90 100
LQIRQDVESC YFAAQTMKMK IQTSFYELPT DSHASLRDSL LTHIQNLKDL
110 120 130 140 150
SPVIVTQLAL AIADLALQMP SWKGCVQTLV EKYSNDVTSL PFLLEILTVL
160 170 180 190 200
PEEVHSRSLR IGANRRTEII EDLAFYSSTV VSLLMTCVEK AGTDEKMLMK
210 220 230 240 250
VFRCLGSWFN LGVLDSNFMA NNKLLALLFE VLQQDKTSSN LHEAASDCVC
260 270 280 290 300
SALYAIENVE TNLPLAMQLF QGVLTLETAY HMAVAREDLD KVLNYCRIFT
310 320 330 340 350
ELCETFLEKI VCTPGQGLGD LRTLELLLIC AGHPQYEVVE ISFNFWYRLG
360 370 380 390 400
EHLYKTNDEV IHSIFKAYIQ RLLHALARHC QLEPDHEGVP EETDDFGEFR
410 420 430 440 450
MRVSDLVKDL IFLIGSMECF AQLYSTLKEG NPPWEVTEAV LFIMAAIAKS
460 470 480 490 500
VDPENNPTLV EVLEGVVHLP ETVHTAVRYT SIELVGEMSE VVDRNPQFLD
510 520 530 540 550
PVLGYLMKGL CEKPLASAAA KAIHNICSVC RDHMAQHFNG LLEIAHSLDS
560 570 580 590 600
FMLSPEAAVG LLKGTALVLA RLPLDKITEC LSELCSVQVM ALKKLLSQEP
610 620 630 640 650
SNGISSDPTV FLDRLAVIFR HTNPIVENGQ THPCQKVIQE IWPVLSETLN
660 670 680 690 700
KHRADNRIVE RCCRCLRFAV RCVGKGSAAL LQPLVTQMVN VYHVHQHSCF
710 720 730 740 750
LYLGSILVDE YGMEEGCRQG LLDMLQALCI PTFQLLEQQN GLQNHPDTVD
760 770 780 790 800
DLFRLATRFI QRSPVTLLRS QVVIPILQWA IASTTLDHRD ANSSVMRFLR
810 820 830 840 850
DLIHTGVAND HEEDFELRKE LIGQVMSQLG QQLVSQLLHT CCFCLPPYTL
860 870 880 890 900
PDVAEVLWEI MQVDRPTFCR WLENSLKGLP KETTVGAVTV THKQLTDFHK
910 920
QVTSAEECKQ VCWALRDFTR LFR
Length:923
Mass (Da):104,170
Last modified:July 5, 2004 - v1
Checksum:iB7D7D2E734A9491E
GO
Isoform 2 (identifier: Q6P2B1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     810-810: D → DLSVFLQ

Note: No experimental confirmation available.
Show »
Length:929
Mass (Da):104,858
Checksum:iD48986152D5D83BF
GO
Isoform 3 (identifier: Q6P2B1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     233-267: QQDKTSSNLHEAASDCVCSALYAIENVETNLPLAM → VSKAAPAIATFNNQPSGTPQCFVGEKHFVCVLRLT
     268-923: Missing.

Show »
Length:267
Mass (Da):29,915
Checksum:i6C1F8AED63310C9B
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei233 – 26735QQDKT…LPLAM → VSKAAPAIATFNNQPSGTPQ CFVGEKHFVCVLRLT in isoform 3. 1 PublicationVSP_019595Add
BLAST
Alternative sequencei268 – 923656Missing in isoform 3. 1 PublicationVSP_019596Add
BLAST
Alternative sequencei810 – 8101D → DLSVFLQ in isoform 2. 1 PublicationVSP_011179

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK049446 mRNA. Translation: BAC33754.1.
AK077714 mRNA. Translation: BAC36974.1.
BC052756 mRNA. Translation: AAH52756.1.
BC064646 mRNA. Translation: AAH64646.1.
CCDSiCCDS19963.1. [Q6P2B1-1]
RefSeqiNP_796270.2. NM_177296.4. [Q6P2B1-1]
XP_006505182.1. XM_006505119.2. [Q6P2B1-2]
UniGeneiMm.276381.
Mm.304472.
Mm.352219.
Mm.424508.
Mm.429470.
Mm.439108.

Genome annotation databases

EnsembliENSMUST00000012679; ENSMUSP00000012679; ENSMUSG00000012535. [Q6P2B1-1]
ENSMUST00000115251; ENSMUSP00000110906; ENSMUSG00000012535. [Q6P2B1-2]
GeneIDi320938.
KEGGimmu:320938.
UCSCiuc009bdy.1. mouse. [Q6P2B1-1]
uc009bea.1. mouse. [Q6P2B1-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK049446 mRNA. Translation: BAC33754.1.
AK077714 mRNA. Translation: BAC36974.1.
BC052756 mRNA. Translation: AAH52756.1.
BC064646 mRNA. Translation: AAH64646.1.
CCDSiCCDS19963.1. [Q6P2B1-1]
RefSeqiNP_796270.2. NM_177296.4. [Q6P2B1-1]
XP_006505182.1. XM_006505119.2. [Q6P2B1-2]
UniGeneiMm.276381.
Mm.304472.
Mm.352219.
Mm.424508.
Mm.429470.
Mm.439108.

3D structure databases

ProteinModelPortaliQ6P2B1.
SMRiQ6P2B1. Positions 4-923.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi236407. 2 interactions.
STRINGi10090.ENSMUSP00000012679.

PTM databases

iPTMnetiQ6P2B1.
PhosphoSiteiQ6P2B1.
SwissPalmiQ6P2B1.

Proteomic databases

EPDiQ6P2B1.
MaxQBiQ6P2B1.
PaxDbiQ6P2B1.
PeptideAtlasiQ6P2B1.
PRIDEiQ6P2B1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000012679; ENSMUSP00000012679; ENSMUSG00000012535. [Q6P2B1-1]
ENSMUST00000115251; ENSMUSP00000110906; ENSMUSG00000012535. [Q6P2B1-2]
GeneIDi320938.
KEGGimmu:320938.
UCSCiuc009bdy.1. mouse. [Q6P2B1-1]
uc009bea.1. mouse. [Q6P2B1-3]

Organism-specific databases

CTDi23534.
MGIiMGI:1196412. Tnpo3.

Phylogenomic databases

eggNOGiKOG2081. Eukaryota.
ENOG410XRKT. LUCA.
GeneTreeiENSGT00530000063347.
HOGENOMiHOG000273876.
HOVERGENiHBG057505.
InParanoidiQ6P2B1.
KOiK15436.
OMAiIKVFRCL.
OrthoDBiEOG091G030R.
PhylomeDBiQ6P2B1.
TreeFamiTF314539.

Miscellaneous databases

ChiTaRSiTnpo3. mouse.
PROiQ6P2B1.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000012535.
CleanExiMM_TNPO3.
ExpressionAtlasiQ6P2B1. baseline and differential.
GenevisibleiQ6P2B1. MM.

Family and domain databases

Gene3Di1.25.10.10. 3 hits.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR013598. Exportin-1/Importin-b-like.
[Graphical view]
PfamiPF08389. Xpo1. 1 hit.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 3 hits.
ProtoNetiSearch...

Entry informationi

Entry nameiTNPO3_MOUSE
AccessioniPrimary (citable) accession number: Q6P2B1
Secondary accession number(s): Q7TSL6, Q8BKX4, Q8BP42
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: July 5, 2004
Last modified: September 7, 2016
This is version 104 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.