Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dermokine

Gene

Dmkn

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

May act as a soluble regulator of keratinocyte differentiation.Curated

GO - Biological processi

  • cell differentiation Source: UniProtKB-KW
  • cornified envelope assembly Source: MGI
Complete GO annotation...

Keywords - Biological processi

Differentiation

Names & Taxonomyi

Protein namesi
Recommended name:
Dermokine
Alternative name(s):
Epidermis-specific secreted protein SK30/SK89
Gene namesi
Name:Dmkn
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 7

Organism-specific databases

MGIiMGI:1920962. Dmkn.

Subcellular locationi

GO - Cellular componenti

  • extracellular exosome Source: MGI
  • extracellular space Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2121By similarityAdd
BLAST
Chaini22 – 517496DermokinePRO_0000330765Add
BLAST

Post-translational modificationi

O-glycosylated.By similarity

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ6P253.
PeptideAtlasiQ6P253.
PRIDEiQ6P253.

PTM databases

PhosphoSiteiQ6P253.

Expressioni

Tissue specificityi

Highly expressed in stratified epithelia; such as the skin, tongue, esophagus, forestomach and vagina. Also found in lung, trachea and urinary bladder.2 Publications

Developmental stagei

Expression begins during the period of stratification at E15.5, increases up to E17.5 and decreases at E18.5.1 Publication

Gene expression databases

BgeeiQ6P253.
ExpressionAtlasiQ6P253. baseline and differential.
GenevisibleiQ6P253. MM.

Interactioni

Subunit structurei

Homooligomer. Seems to be able to homodimerize and homotrimerize (By similarity).By similarity

Structurei

3D structure databases

ProteinModelPortaliQ6P253.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi211 – 328118Ser-richAdd
BLAST
Compositional biasi499 – 5046Poly-Ser

Sequence similaritiesi

Belongs to the dermokine family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

GeneTreeiENSGT00570000079107.
HOGENOMiHOG000168236.
HOVERGENiHBG107816.
InParanoidiQ6P253.
PhylomeDBiQ6P253.

Family and domain databases

InterProiIPR033541. Dermokine.
[Graphical view]
PANTHERiPTHR36881. PTHR36881. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6P253-1) [UniParc]FASTAAdd to basket

Also known as: Dermokine-beta

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKLQGSLACL LLALCLGGGA ANPLHSGGEG TGASAAHGAG DAISHGIGEA
60 70 80 90 100
VGQGAKEAAS SGIQNALGQG HGEEGGSTLM GSRGDVFEHR LGEAARSLGN
110 120 130 140 150
AGNEIGRQAE DIIRQGVDAV HNAGSWGTSG GHGAYGSQGG AGVQGNPGPQ
160 170 180 190 200
GTPWASGGNY GTNSLGGSVG QGGNGGPLDY ETNAQGAVAQ PGYGTVRGNN
210 220 230 240 250
QNSGCTNPPP SGSHESFSNS GGSSNDGSRG SQGSHGSNGQ GSSGRGGGQG
260 270 280 290 300
NSDNNGSSSS SSGSNSGNSN SGNSGNSNSG NSGNSGSGSR DIETSNFDEG
310 320 330 340 350
YSVSRGTGSR GGSGGSGGSG GSGGSGGSGG GNKPECNNPG NDVRMAGGSG
360 370 380 390 400
SQGHGSNGGN IQKEAVNGLN TMNSDASTLP FNIDNFWENL KSKTRFINWD
410 420 430 440 450
AINKGHAPSP STRALLYFRK LWENFKRSTP FFNWKQIEGS DLSSLQKRAG
460 470 480 490 500
GADQFSKPEA RQDLSADSSK NYYNNQQVNP TYNWQYYTKT TAKAGVTPSS
510
SSASRAQPGL LKWLKFW
Length:517
Mass (Da):51,661
Last modified:April 29, 2008 - v2
Checksum:i3FCEDECAA2B5E222
GO
Isoform 2 (identifier: Q6P253-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     291-305: Missing.
     314-322: Missing.

Show »
Length:493
Mass (Da):49,356
Checksum:iF201FF97D29DF5E8
GO
Isoform 3 (identifier: Q6P253-3) [UniParc]FASTAAdd to basket

Also known as: Dermokine-alpha

The sequence of this isoform differs from the canonical sequence as follows:
     1-408: Missing.
     409-438: SPSTRALLYFRKLWENFKRSTPFFNWKQIE → MKPVTASALLLILLGVAWRGDSHSW

Show »
Length:104
Mass (Da):11,484
Checksum:iE9333661E3763C03
GO
Isoform 4 (identifier: Q6P253-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     314-322: Missing.

Show »
Length:508
Mass (Da):51,057
Checksum:i1B7913E7275A1926
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti88 – 881E → D in AAR20796 (PubMed:15256262).Curated
Sequence conflicti107 – 1071R → K in AAR20796 (PubMed:15256262).Curated
Sequence conflicti118 – 1181D → N in AAR20796 (PubMed:15256262).Curated
Sequence conflicti134 – 1341A → P in AAR20796 (PubMed:15256262).Curated
Sequence conflicti179 – 1791D → N in AAR20796 (PubMed:15256262).Curated
Sequence conflicti179 – 1791D → N in AAT68267 (PubMed:15234001).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 408408Missing in isoform 3. 2 PublicationsVSP_033107Add
BLAST
Alternative sequencei291 – 30515Missing in isoform 2. 1 PublicationVSP_033108Add
BLAST
Alternative sequencei314 – 3229Missing in isoform 2 and isoform 4. 3 PublicationsVSP_033109
Alternative sequencei409 – 43830SPSTR…WKQIE → MKPVTASALLLILLGVAWRG DSHSW in isoform 3. 2 PublicationsVSP_033110Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY444557 mRNA. Translation: AAR20796.1.
AY444558 mRNA. Translation: AAR20797.1.
AY622962 mRNA. Translation: AAT68266.1.
AY622963 mRNA. Translation: AAT68267.1.
AK003695 mRNA. Translation: BAB22943.1.
BC064724 mRNA. Translation: AAH64724.1.
CCDSiCCDS39892.1. [Q6P253-4]
CCDS39893.1. [Q6P253-3]
CCDS52184.1. [Q6P253-2]
RefSeqiNP_001159646.1. NM_001166174.1.
NP_082894.1. NM_028618.2. [Q6P253-3]
NP_766487.3. NM_172899.4.
UniGeneiMm.30138.

Genome annotation databases

EnsembliENSMUST00000041703; ENSMUSP00000042300; ENSMUSG00000060962. [Q6P253-3]
GeneIDi73712.
KEGGimmu:73712.
UCSCiuc009ggk.2. mouse. [Q6P253-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY444557 mRNA. Translation: AAR20796.1.
AY444558 mRNA. Translation: AAR20797.1.
AY622962 mRNA. Translation: AAT68266.1.
AY622963 mRNA. Translation: AAT68267.1.
AK003695 mRNA. Translation: BAB22943.1.
BC064724 mRNA. Translation: AAH64724.1.
CCDSiCCDS39892.1. [Q6P253-4]
CCDS39893.1. [Q6P253-3]
CCDS52184.1. [Q6P253-2]
RefSeqiNP_001159646.1. NM_001166174.1.
NP_082894.1. NM_028618.2. [Q6P253-3]
NP_766487.3. NM_172899.4.
UniGeneiMm.30138.

3D structure databases

ProteinModelPortaliQ6P253.
ModBaseiSearch...
MobiDBiSearch...

PTM databases

PhosphoSiteiQ6P253.

Proteomic databases

MaxQBiQ6P253.
PeptideAtlasiQ6P253.
PRIDEiQ6P253.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000041703; ENSMUSP00000042300; ENSMUSG00000060962. [Q6P253-3]
GeneIDi73712.
KEGGimmu:73712.
UCSCiuc009ggk.2. mouse. [Q6P253-3]

Organism-specific databases

CTDi93099.
MGIiMGI:1920962. Dmkn.

Phylogenomic databases

GeneTreeiENSGT00570000079107.
HOGENOMiHOG000168236.
HOVERGENiHBG107816.
InParanoidiQ6P253.
PhylomeDBiQ6P253.

Miscellaneous databases

PROiQ6P253.
SOURCEiSearch...

Gene expression databases

BgeeiQ6P253.
ExpressionAtlasiQ6P253. baseline and differential.
GenevisibleiQ6P253. MM.

Family and domain databases

InterProiIPR033541. Dermokine.
[Graphical view]
PANTHERiPTHR36881. PTHR36881. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of a conserved cluster of skin-specific genes encoding secreted proteins."
    Moffatt P., Salois P., St Amant N., Gaumond M.-H., Lanctot C.
    Gene 334:123-131(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    Strain: CD-1.
  2. "Identification of novel keratinocyte-secreted peptides dermokine-alpha/-beta and a new stratified epithelium-secreted protein gene complex on human chromosome 19q13.1."
    Matsui T., Hayashi-Kisumi F., Kinoshita Y., Katahira S., Morita K., Miyachi Y., Ono Y., Imai T., Tanigawa Y., Komiya T., Tsukita S.
    Genomics 84:384-397(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE, FUNCTION.
    Strain: BALB/cJ.
    Tissue: Skin.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Strain: C57BL/6J.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Strain: C57BL/6J.
    Tissue: Embryo.

Entry informationi

Entry nameiDMKN_MOUSE
AccessioniPrimary (citable) accession number: Q6P253
Secondary accession number(s): Q6E0U6, Q6SZJ9, Q9D1D0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: April 29, 2008
Last modified: July 6, 2016
This is version 75 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.