Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Methyltransferase-like protein 2B

Gene

METTL2B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Probable S-adenosyl-L-methionine-dependent methyltransferase that mediates 3-methylcytidine modification of some tRNAs.1 Publication

GO - Molecular functioni

  • tRNA (cytosine) methyltransferase activity Source: UniProtKB

GO - Biological processi

  • tRNA methylation Source: UniProtKB

Keywordsi

Molecular functionMethyltransferase, Transferase
LigandS-adenosyl-L-methionine

Enzyme and pathway databases

BRENDAi2.1.1.268. 2681.
2.1.1.B109. 2681.

Names & Taxonomyi

Protein namesi
Recommended name:
Methyltransferase-like protein 2B (EC:2.1.1.-)
Gene namesi
Name:METTL2B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000165055.15.
HGNCiHGNC:18272. METTL2B.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134924546.

Polymorphism and mutation databases

BioMutaiMETTL2B.
DMDMi317373413.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00003288472 – 378Methyltransferase-like protein 2BAdd BLAST377

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1
Modified residuei4PhosphoserineCombined sources1
Modified residuei154PhosphothreonineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ6P1Q9.
MaxQBiQ6P1Q9.
PaxDbiQ6P1Q9.
PeptideAtlasiQ6P1Q9.
PRIDEiQ6P1Q9.

PTM databases

iPTMnetiQ6P1Q9.
PhosphoSitePlusiQ6P1Q9.

Expressioni

Gene expression databases

BgeeiENSG00000165055.
CleanExiHS_METTL2B.
ExpressionAtlasiQ6P1Q9. baseline and differential.
GenevisibleiQ6P1Q9. HS.

Interactioni

Protein-protein interaction databases

BioGridi120910. 7 interactors.
IntActiQ6P1Q9. 1 interactor.
STRINGi9606.ENSP00000262432.

Structurei

3D structure databases

ProteinModelPortaliQ6P1Q9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG2361. Eukaryota.
ENOG410YAN4. LUCA.
GeneTreeiENSGT00520000055554.
HOGENOMiHOG000182278.
HOVERGENiHBG075344.
InParanoidiQ6P1Q9.
OMAiKSEVCEC.
OrthoDBiEOG091G1235.
PhylomeDBiQ6P1Q9.
TreeFamiTF323232.

Family and domain databases

InterProiView protein in InterPro
IPR026113. MeTrfase.
IPR029063. SAM-dependent_MTases.
PANTHERiPTHR22809. PTHR22809. 1 hit.
PIRSFiPIRSF037755. Mettl2_prd. 1 hit.
SUPFAMiSSF53335. SSF53335. 2 hits.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6P1Q9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGSYPEGAP AILADKRQQF GSRFLSDPAR VFHHNAWDNV EWSEEQAAAA
60 70 80 90 100
ERKVQENSIQ RVCQEKQVDY EINAHKYWND FYKIHENGFF KDRHWLFTEF
110 120 130 140 150
PELAPSQNQN HLKDWFLENK SEVCECRNNE DGPGLIMEEQ HKCSSKSLEH
160 170 180 190 200
KTQTPPVEEN VTQKISDLEI CADEFPGSSA TYRILEVGCG VGNTVFPILQ
210 220 230 240 250
TNNDPGLFVY CCDFSSTAIE LVQTNSEYDP SRCFAFVHDL CDEEKSYPVP
260 270 280 290 300
KGSLDIIILI FVLSAVVPDK MQKAINRLSR LLKPGGMVLL RDYGRYDMAQ
310 320 330 340 350
LRFKKGQCLS GNFYVRGDGT RVYFFTQEEL DTLFTTAGLE KVQNLVDRRL
360 370
QVNRGKQLTM YRVWIQCKYC KPLLSSTS
Note: No experimental confirmation available.
Length:378
Mass (Da):43,426
Last modified:January 11, 2011 - v3
Checksum:iA9719EF1074BA011
GO
Isoform 2 (identifier: Q6P1Q9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: MAGSYPEGAPAILADKRQQFGSRFLSDPARVFHHNAWDNVEWSEEQAAAAERKVQENSIQRVCQEKQ → MP

Show »
Length:313
Mass (Da):36,057
Checksum:i9A7C6CE35B445F0D
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05946568V → I1 PublicationCorresponds to variant dbSNP:rs2288557Ensembl.1
Natural variantiVAR_042547124C → R. Corresponds to variant dbSNP:rs2896399Ensembl.1
Natural variantiVAR_042548129N → H. Corresponds to variant dbSNP:rs2023329Ensembl.1
Natural variantiVAR_042549169E → K. Corresponds to variant dbSNP:rs1065267Ensembl.1
Natural variantiVAR_042550266V → I2 PublicationsCorresponds to variant dbSNP:rs2562741Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0328161 – 67MAGSY…CQEKQ → MP in isoform 2. 2 PublicationsAdd BLAST67

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK002212 mRNA. Translation: BAA92136.1.
AK302775 mRNA. Translation: BAG63980.1.
AC010655 Genomic DNA. No translation available.
AC090114 Genomic DNA. No translation available.
BC064929 mRNA. Translation: AAH64929.1.
BC107586 mRNA. Translation: AAI07587.1.
BC121115 mRNA. Translation: AAI21116.1.
BC121116 mRNA. Translation: AAI21117.1.
CCDSiCCDS5803.2. [Q6P1Q9-1]
RefSeqiNP_060866.2. NM_018396.2. [Q6P1Q9-1]
UniGeneiHs.433213.

Genome annotation databases

EnsembliENST00000262432; ENSP00000262432; ENSG00000165055. [Q6P1Q9-1]
ENST00000480046; ENSP00000418402; ENSG00000165055. [Q6P1Q9-2]
GeneIDi55798.
KEGGihsa:55798.
UCSCiuc003vnf.3. human. [Q6P1Q9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiMET2B_HUMAN
AccessioniPrimary (citable) accession number: Q6P1Q9
Secondary accession number(s): B4DZ68, Q0IJ54, Q3B7J1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: January 11, 2011
Last modified: September 27, 2017
This is version 114 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families