Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Lethal(2) giant larvae protein homolog 2

Gene

LLGL2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Part of a complex with GPSM2/LGN, PRKCI/aPKC and PARD6B/Par-6, which may ensure the correct organization and orientation of bipolar spindles for normal cell division. This complex plays roles in the initial phase of the establishment of epithelial cell polarity.1 Publication

GO - Molecular functioni

  • GTPase activator activity Source: GO_Central
  • PDZ domain binding Source: UniProtKB
  • Rab GTPase binding Source: GO_Central

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Cell cycle, Cell division, Exocytosis

Enzyme and pathway databases

SignaLinkiQ6P1M3.

Names & Taxonomyi

Protein namesi
Recommended name:
Lethal(2) giant larvae protein homolog 2
Alternative name(s):
HGL
Gene namesi
Name:LLGL2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:6629. LLGL2.

Subcellular locationi

  • Cytoplasm 1 Publication

  • Note: Localized in the perinuclear structure and faintly at the cell-cell contacts sites in the interphase. Localized at the cell periphery during metaphase. Cortical localization in mitotic cells. Found in the lateral region of polarized epithelial cells.

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi641S → A: No effect on phosphorylation. 1 Publication1
Mutagenesisi645S → A: Decrease of phosphorylation. 1 Publication1
Mutagenesisi649S → A: Decrease of phosphorylation. 1 Publication1
Mutagenesisi653S → A: Loss of phosphorylation. 1 Publication1
Mutagenesisi660S → A: Decrease of phosphorylation. 1 Publication1
Mutagenesisi663S → A: No effect on phosphorylation. 1 Publication1

Organism-specific databases

DisGeNETi3993.
OpenTargetsiENSG00000073350.
PharmGKBiPA30397.

Polymorphism and mutation databases

BioMutaiLLGL2.
DMDMi93204600.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002327281 – 1020Lethal(2) giant larvae protein homolog 2Add BLAST1020

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei653Phosphoserine1 Publication1
Modified residuei965PhosphoserineCombined sources1
Modified residuei1015PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated at Ser-653 by PRKCI. Phosphorylation is enhanced during cell polarization induced by calcium. Phosphorylation may occur during the cell-cell contact-induced cell polarization and may contribute to the segregation of LLGL2 from the PRKCI/aPKC and PARD6B/Par-6 complex.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ6P1M3.
MaxQBiQ6P1M3.
PaxDbiQ6P1M3.
PeptideAtlasiQ6P1M3.
PRIDEiQ6P1M3.

PTM databases

iPTMnetiQ6P1M3.
PhosphoSitePlusiQ6P1M3.

Expressioni

Gene expression databases

BgeeiENSG00000073350.
CleanExiHS_LLGL2.
ExpressionAtlasiQ6P1M3. baseline and differential.
GenevisibleiQ6P1M3. HS.

Organism-specific databases

HPAiHPA022913.

Interactioni

Subunit structurei

Interacts with GPSM2/LGN, PRKCI/aPKC and PARD6B/Par-6. The complex is enhanced during mitosis. Interacts with VPRBP.3 Publications

GO - Molecular functioni

  • PDZ domain binding Source: UniProtKB
  • Rab GTPase binding Source: GO_Central

Protein-protein interaction databases

BioGridi110181. 95 interactors.
IntActiQ6P1M3. 55 interactors.
MINTiMINT-261325.
STRINGi9606.ENSP00000376333.

Structurei

Secondary structure

11020
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi645 – 649Combined sources5
Helixi652 – 656Combined sources5

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3WP0X-ray2.04B640-654[»]
3WP1X-ray2.80A646-657[»]
ProteinModelPortaliQ6P1M3.
SMRiQ6P1M3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati36 – 69WD 1Add BLAST34
Repeati76 – 117WD 2Add BLAST42
Repeati132 – 169WD 3Add BLAST38
Repeati193 – 227WD 4Add BLAST35
Repeati233 – 268WD 5Add BLAST36
Repeati282 – 324WD 6Add BLAST43
Repeati332 – 366WD 7Add BLAST35
Repeati388 – 464WD 8Add BLAST77
Repeati508 – 583WD 9Add BLAST76
Repeati592 – 653WD 10Add BLAST62
Repeati713 – 769WD 11Add BLAST57
Repeati778 – 830WD 12Add BLAST53
Repeati835 – 888WD 13Add BLAST54
Repeati902 – 925WD 14Add BLAST24

Sequence similaritiesi

Belongs to the WD repeat L(2)GL family.Curated
Contains 14 WD repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiKOG1983. Eukaryota.
ENOG410XS6Z. LUCA.
GeneTreeiENSGT00390000000018.
HOGENOMiHOG000115700.
HOVERGENiHBG052711.
InParanoidiQ6P1M3.
KOiK06094.
OMAiLVQCQPP.
OrthoDBiEOG091G01L0.
PhylomeDBiQ6P1M3.
TreeFamiTF314585.

Family and domain databases

Gene3Di2.130.10.10. 3 hits.
InterProiIPR000664. Lethal2_giant.
IPR013577. LLGL2.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF08366. LLGL. 1 hit.
PF00400. WD40. 1 hit.
[Graphical view]
PRINTSiPR00962. LETHAL2GIANT.
SMARTiSM00320. WD40. 5 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 5 hits.
PROSITEiPS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform C (identifier: Q6P1M3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRRFLRPGHD PVRERLKRDL FQFNKTVEHG FPHQPSALGY SPSLRILAIG
60 70 80 90 100
TRSGAIKLYG APGVEFMGLH QENNAVTQIH LLPGQCQLVT LLDDNSLHLW
110 120 130 140 150
SLKVKGGASE LQEDESFTLR GPPGAAPSAT QITVVLPHSS CELLYLGTES
160 170 180 190 200
GNVFVVQLPA FRALEDRTIS SDAVLQRLPE EARHRRVFEM VEALQEHPRD
210 220 230 240 250
PNQILIGYSR GLVVIWDLQG SRVLYHFLSS QQLENIWWQR DGRLLVSCHS
260 270 280 290 300
DGSYCQWPVS SEAQQPEPLR SLVPYGPFPC KAITRILWLT TRQGLPFTIF
310 320 330 340 350
QGGMPRASYG DRHCISVIHD GQQTAFDFTS RVIGFTVLTE ADPAATFDDP
360 370 380 390 400
YALVVLAEEE LVVIDLQTAG WPPVQLPYLA SLHCSAITCS HHVSNIPLKL
410 420 430 440 450
WERIIAAGSR QNAHFSTMEW PIDGGTSLTP APPQRDLLLT GHEDGTVRFW
460 470 480 490 500
DASGVCLRLL YKLSTVRVFL TDTDPNENFS AQGEDEWPPL RKVGSFDPYS
510 520 530 540 550
DDPRLGIQKI FLCKYSGYLA VAGTAGQVLV LELNDEAAEQ AVEQVEADLL
560 570 580 590 600
QDQEGYRWKG HERLAARSGP VRFEPGFQPF VLVQCQPPAV VTSLALHSEW
610 620 630 640 650
RLVAFGTSHG FGLFDHQQRR QVFVKCTLHP SDQLALEGPL SRVKSLKKSL
660 670 680 690 700
RQSFRRMRRS RVSSRKRHPA GPPGEAQEGS AKAERPGLQN MELAPVQRKI
710 720 730 740 750
EARSAEDSFT GFVRTLYFAD TYLKDSSRHC PSLWAGTNGG TIYAFSLRVP
760 770 780 790 800
PAERRMDEPV RAEQAKEIQL MHRAPVVGIL VLDGHSVPLP EPLEVAHDLS
810 820 830 840 850
KSPDMQGSHQ LLVVSEEQFK VFTLPKVSAK LKLKLTALEG SRVRRVSVAH
860 870 880 890 900
FGSRRAEDYG EHHLAVLTNL GDIQVVSLPL LKPQVRYSCI RREDVSGIAS
910 920 930 940 950
CVFTKYGQGF YLISPSEFER FSLSTKWLVE PRCLVDSAET KNHRPGNGAG
960 970 980 990 1000
PKKAPSRARN SGTQSDGEEK QPGLVMERAL LSDERVLKEI QSTLEGDRGS
1010 1020
GNWRSHRAAV GCSLSNGGAE
Length:1,020
Mass (Da):113,448
Last modified:April 18, 2006 - v2
Checksum:i9C36BFF9F94314B5
GO
Isoform A (identifier: Q6P1M3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     986-1020: VLKEIQSTLEGDRGSGNWRSHRAAVGCSLSNGGAE → AATGVHIEPPWGAASAMAEQSEWLSVQAAR

Note: No experimental confirmation available.
Show »
Length:1,015
Mass (Da):112,927
Checksum:iF2C96A62BAA08AE4
GO
Isoform B (identifier: Q6P1M3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     346-356: TFDDPYALVVL → SRRASGVGAQG
     357-1020: Missing.

Note: No experimental confirmation available.
Show »
Length:356
Mass (Da):39,668
Checksum:i0A6C67EDFB69D544
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05006945R → H.1 PublicationCorresponds to variant rs1671036dbSNPEnsembl.1
Natural variantiVAR_050070479F → L.1 PublicationCorresponds to variant rs1671021dbSNPEnsembl.1
Natural variantiVAR_050071488P → L.Corresponds to variant rs35991442dbSNPEnsembl.1
Natural variantiVAR_050072490L → P.Corresponds to variant rs1671021dbSNPEnsembl.1
Natural variantiVAR_034058748R → H.Corresponds to variant rs35474687dbSNPEnsembl.1
Natural variantiVAR_050073759P → S.1 PublicationCorresponds to variant rs1661715dbSNPEnsembl.1
Natural variantiVAR_050075790P → L.Corresponds to variant rs1661714dbSNPEnsembl.1
Natural variantiVAR_0340591001G → S.Corresponds to variant rs35886912dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_047387346 – 356TFDDPYALVVL → SRRASGVGAQG in isoform B. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_047388357 – 1020Missing in isoform B. 1 PublicationAdd BLAST664
Alternative sequenceiVSP_017946986 – 1020VLKEI…NGGAE → AATGVHIEPPWGAASAMAEQ SEWLSVQAAR in isoform A. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X87342 mRNA. Translation: CAA60780.1.
AC100787 Genomic DNA. No translation available.
BC006503 mRNA. Translation: AAH06503.1.
BC010879 mRNA. Translation: AAH10879.1.
BC064994 mRNA. Translation: AAH64994.1.
CCDSiCCDS11725.1. [Q6P1M3-2]
CCDS32733.1. [Q6P1M3-1]
CCDS45776.1. [Q6P1M3-3]
PIRiS55474.
RefSeqiNP_001015002.1. NM_001015002.1. [Q6P1M3-3]
NP_001026973.1. NM_001031803.1. [Q6P1M3-1]
NP_004515.2. NM_004524.2. [Q6P1M3-2]
XP_016880115.1. XM_017024626.1. [Q6P1M3-1]
XP_016880119.1. XM_017024630.1. [Q6P1M3-2]
UniGeneiHs.514477.

Genome annotation databases

EnsembliENST00000167462; ENSP00000167462; ENSG00000073350. [Q6P1M3-2]
ENST00000375227; ENSP00000364375; ENSG00000073350. [Q6P1M3-3]
ENST00000392550; ENSP00000376333; ENSG00000073350. [Q6P1M3-1]
ENST00000578363; ENSP00000464603; ENSG00000073350. [Q6P1M3-3]
GeneIDi3993.
KEGGihsa:3993.
UCSCiuc002jog.2. human. [Q6P1M3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X87342 mRNA. Translation: CAA60780.1.
AC100787 Genomic DNA. No translation available.
BC006503 mRNA. Translation: AAH06503.1.
BC010879 mRNA. Translation: AAH10879.1.
BC064994 mRNA. Translation: AAH64994.1.
CCDSiCCDS11725.1. [Q6P1M3-2]
CCDS32733.1. [Q6P1M3-1]
CCDS45776.1. [Q6P1M3-3]
PIRiS55474.
RefSeqiNP_001015002.1. NM_001015002.1. [Q6P1M3-3]
NP_001026973.1. NM_001031803.1. [Q6P1M3-1]
NP_004515.2. NM_004524.2. [Q6P1M3-2]
XP_016880115.1. XM_017024626.1. [Q6P1M3-1]
XP_016880119.1. XM_017024630.1. [Q6P1M3-2]
UniGeneiHs.514477.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3WP0X-ray2.04B640-654[»]
3WP1X-ray2.80A646-657[»]
ProteinModelPortaliQ6P1M3.
SMRiQ6P1M3.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110181. 95 interactors.
IntActiQ6P1M3. 55 interactors.
MINTiMINT-261325.
STRINGi9606.ENSP00000376333.

PTM databases

iPTMnetiQ6P1M3.
PhosphoSitePlusiQ6P1M3.

Polymorphism and mutation databases

BioMutaiLLGL2.
DMDMi93204600.

Proteomic databases

EPDiQ6P1M3.
MaxQBiQ6P1M3.
PaxDbiQ6P1M3.
PeptideAtlasiQ6P1M3.
PRIDEiQ6P1M3.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000167462; ENSP00000167462; ENSG00000073350. [Q6P1M3-2]
ENST00000375227; ENSP00000364375; ENSG00000073350. [Q6P1M3-3]
ENST00000392550; ENSP00000376333; ENSG00000073350. [Q6P1M3-1]
ENST00000578363; ENSP00000464603; ENSG00000073350. [Q6P1M3-3]
GeneIDi3993.
KEGGihsa:3993.
UCSCiuc002jog.2. human. [Q6P1M3-1]

Organism-specific databases

CTDi3993.
DisGeNETi3993.
GeneCardsiLLGL2.
HGNCiHGNC:6629. LLGL2.
HPAiHPA022913.
neXtProtiNX_Q6P1M3.
OpenTargetsiENSG00000073350.
PharmGKBiPA30397.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1983. Eukaryota.
ENOG410XS6Z. LUCA.
GeneTreeiENSGT00390000000018.
HOGENOMiHOG000115700.
HOVERGENiHBG052711.
InParanoidiQ6P1M3.
KOiK06094.
OMAiLVQCQPP.
OrthoDBiEOG091G01L0.
PhylomeDBiQ6P1M3.
TreeFamiTF314585.

Enzyme and pathway databases

SignaLinkiQ6P1M3.

Miscellaneous databases

ChiTaRSiLLGL2. human.
GenomeRNAii3993.
PROiQ6P1M3.

Gene expression databases

BgeeiENSG00000073350.
CleanExiHS_LLGL2.
ExpressionAtlasiQ6P1M3. baseline and differential.
GenevisibleiQ6P1M3. HS.

Family and domain databases

Gene3Di2.130.10.10. 3 hits.
InterProiIPR000664. Lethal2_giant.
IPR013577. LLGL2.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF08366. LLGL. 1 hit.
PF00400. WD40. 1 hit.
[Graphical view]
PRINTSiPR00962. LETHAL2GIANT.
SMARTiSM00320. WD40. 5 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 5 hits.
PROSITEiPS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiL2GL2_HUMAN
AccessioniPrimary (citable) accession number: Q6P1M3
Secondary accession number(s): Q14521, Q9BR62
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 18, 2006
Last sequence update: April 18, 2006
Last modified: November 30, 2016
This is version 125 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Overexpression of LLGL2 inhibits the tight junction formation.

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.