SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6P1M3

- L2GL2_HUMAN

UniProt

Q6P1M3 - L2GL2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Lethal(2) giant larvae protein homolog 2
Gene
LLGL2
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Part of a complex with GPSM2/LGN, PRKCI/aPKC and PARD6B/Par-6, which may ensure the correct organization and orientation of bipolar spindles for normal cell division. This complex plays roles in the initial phase of the establishment of epithelial cell polarity.1 Publication

GO - Molecular functioni

  1. PDZ domain binding Source: UniProtKB
  2. protein binding Source: UniProtKB
Complete GO annotation...

GO - Biological processi

  1. cell cycle Source: UniProtKB-KW
  2. cell division Source: UniProtKB-KW
  3. exocytosis Source: UniProtKB-KW
  4. regulation of establishment or maintenance of cell polarity Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Cell cycle, Cell division, Exocytosis

Enzyme and pathway databases

SignaLinkiQ6P1M3.

Names & Taxonomyi

Protein namesi
Recommended name:
Lethal(2) giant larvae protein homolog 2
Alternative name(s):
HGL
Gene namesi
Name:LLGL2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:6629. LLGL2.

Subcellular locationi

Cytoplasm
Note: Localized in the perinuclear structure and faintly at the cell-cell contacts sites in the interphase. Localized at the cell periphery during metaphase. Cortical localization in mitotic cells. Found in the lateral region of polarized epithelial cells.1 Publication

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi641 – 6411S → A: No effect on phosphorylation. 1 Publication
Mutagenesisi645 – 6451S → A: Decrease of phosphorylation. 1 Publication
Mutagenesisi649 – 6491S → A: Decrease of phosphorylation. 1 Publication
Mutagenesisi653 – 6531S → A: Loss of phosphorylation. 1 Publication
Mutagenesisi660 – 6601S → A: Decrease of phosphorylation. 1 Publication
Mutagenesisi663 – 6631S → A: No effect on phosphorylation. 1 Publication

Organism-specific databases

PharmGKBiPA30397.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10201020Lethal(2) giant larvae protein homolog 2
PRO_0000232728Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei653 – 6531Phosphoserine1 Publication
Modified residuei1015 – 10151Phosphoserine1 Publication

Post-translational modificationi

Phosphorylated at Ser-653 by PRKCI. Phosphorylation is enhanced during cell polarization induced by calcium. Phosphorylation may occur during the cell-cell contact-induced cell polarization and may contribute to the segregation of LLGL2 from the PRKCI/aPKC and PARD6B/Par-6 complex.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ6P1M3.
PaxDbiQ6P1M3.
PRIDEiQ6P1M3.

PTM databases

PhosphoSiteiQ6P1M3.

Expressioni

Gene expression databases

ArrayExpressiQ6P1M3.
BgeeiQ6P1M3.
CleanExiHS_LLGL2.
GenevestigatoriQ6P1M3.

Organism-specific databases

HPAiHPA022913.

Interactioni

Subunit structurei

Interacts with GPSM2/LGN, PRKCI/aPKC and PARD6B/Par-6. The complex is enhanced during mitosis. Interacts with VPRBP.3 Publications

Protein-protein interaction databases

BioGridi110181. 6 interactions.
IntActiQ6P1M3. 5 interactions.
MINTiMINT-261325.
STRINGi9606.ENSP00000376333.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi652 – 6565

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3WP0X-ray2.04B640-654[»]
3WP1X-ray2.80A646-657[»]
ProteinModelPortaliQ6P1M3.
SMRiQ6P1M3. Positions 217-247, 589-621.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati36 – 6934WD 1
Add
BLAST
Repeati76 – 11742WD 2
Add
BLAST
Repeati132 – 16938WD 3
Add
BLAST
Repeati193 – 22735WD 4
Add
BLAST
Repeati233 – 26836WD 5
Add
BLAST
Repeati282 – 32443WD 6
Add
BLAST
Repeati332 – 36635WD 7
Add
BLAST
Repeati388 – 46477WD 8
Add
BLAST
Repeati508 – 58376WD 9
Add
BLAST
Repeati592 – 65362WD 10
Add
BLAST
Repeati713 – 76957WD 11
Add
BLAST
Repeati778 – 83053WD 12
Add
BLAST
Repeati835 – 88854WD 13
Add
BLAST
Repeati902 – 92524WD 14
Add
BLAST

Sequence similaritiesi

Belongs to the WD repeat L(2)GL family.
Contains 14 WD repeats.

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiNOG289584.
HOGENOMiHOG000115700.
HOVERGENiHBG052711.
InParanoidiQ6P1M3.
KOiK06094.
OMAiQCQPPAV.
OrthoDBiEOG79W94C.
PhylomeDBiQ6P1M3.
TreeFamiTF314585.

Family and domain databases

Gene3Di2.130.10.10. 3 hits.
InterProiIPR000664. Lethal2_giant.
IPR013577. LLGL2.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF08366. LLGL. 1 hit.
PF00400. WD40. 1 hit.
[Graphical view]
PRINTSiPR00962. LETHAL2GIANT.
SMARTiSM00320. WD40. 5 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 5 hits.
PROSITEiPS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform C (identifier: Q6P1M3-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MRRFLRPGHD PVRERLKRDL FQFNKTVEHG FPHQPSALGY SPSLRILAIG     50
TRSGAIKLYG APGVEFMGLH QENNAVTQIH LLPGQCQLVT LLDDNSLHLW 100
SLKVKGGASE LQEDESFTLR GPPGAAPSAT QITVVLPHSS CELLYLGTES 150
GNVFVVQLPA FRALEDRTIS SDAVLQRLPE EARHRRVFEM VEALQEHPRD 200
PNQILIGYSR GLVVIWDLQG SRVLYHFLSS QQLENIWWQR DGRLLVSCHS 250
DGSYCQWPVS SEAQQPEPLR SLVPYGPFPC KAITRILWLT TRQGLPFTIF 300
QGGMPRASYG DRHCISVIHD GQQTAFDFTS RVIGFTVLTE ADPAATFDDP 350
YALVVLAEEE LVVIDLQTAG WPPVQLPYLA SLHCSAITCS HHVSNIPLKL 400
WERIIAAGSR QNAHFSTMEW PIDGGTSLTP APPQRDLLLT GHEDGTVRFW 450
DASGVCLRLL YKLSTVRVFL TDTDPNENFS AQGEDEWPPL RKVGSFDPYS 500
DDPRLGIQKI FLCKYSGYLA VAGTAGQVLV LELNDEAAEQ AVEQVEADLL 550
QDQEGYRWKG HERLAARSGP VRFEPGFQPF VLVQCQPPAV VTSLALHSEW 600
RLVAFGTSHG FGLFDHQQRR QVFVKCTLHP SDQLALEGPL SRVKSLKKSL 650
RQSFRRMRRS RVSSRKRHPA GPPGEAQEGS AKAERPGLQN MELAPVQRKI 700
EARSAEDSFT GFVRTLYFAD TYLKDSSRHC PSLWAGTNGG TIYAFSLRVP 750
PAERRMDEPV RAEQAKEIQL MHRAPVVGIL VLDGHSVPLP EPLEVAHDLS 800
KSPDMQGSHQ LLVVSEEQFK VFTLPKVSAK LKLKLTALEG SRVRRVSVAH 850
FGSRRAEDYG EHHLAVLTNL GDIQVVSLPL LKPQVRYSCI RREDVSGIAS 900
CVFTKYGQGF YLISPSEFER FSLSTKWLVE PRCLVDSAET KNHRPGNGAG 950
PKKAPSRARN SGTQSDGEEK QPGLVMERAL LSDERVLKEI QSTLEGDRGS 1000
GNWRSHRAAV GCSLSNGGAE 1020
Length:1,020
Mass (Da):113,448
Last modified:April 18, 2006 - v2
Checksum:i9C36BFF9F94314B5
GO
Isoform A (identifier: Q6P1M3-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     986-1020: VLKEIQSTLEGDRGSGNWRSHRAAVGCSLSNGGAE → AATGVHIEPPWGAASAMAEQSEWLSVQAAR

Note: No experimental confirmation available.

Show »
Length:1,015
Mass (Da):112,927
Checksum:iF2C96A62BAA08AE4
GO
Isoform B (identifier: Q6P1M3-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     346-356: TFDDPYALVVL → SRRASGVGAQG
     357-1020: Missing.

Note: No experimental confirmation available.

Show »
Length:356
Mass (Da):39,668
Checksum:i0A6C67EDFB69D544
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti45 – 451R → H.1 Publication
Corresponds to variant rs1671036 [ dbSNP | Ensembl ].
VAR_050069
Natural varianti479 – 4791F → L.1 Publication
Corresponds to variant rs1671021 [ dbSNP | Ensembl ].
VAR_050070
Natural varianti488 – 4881P → L.
Corresponds to variant rs35991442 [ dbSNP | Ensembl ].
VAR_050071
Natural varianti490 – 4901L → P.
Corresponds to variant rs1671021 [ dbSNP | Ensembl ].
VAR_050072
Natural varianti748 – 7481R → H.
Corresponds to variant rs35474687 [ dbSNP | Ensembl ].
VAR_034058
Natural varianti759 – 7591P → S.1 Publication
Corresponds to variant rs1661715 [ dbSNP | Ensembl ].
VAR_050073
Natural varianti790 – 7901P → L.
Corresponds to variant rs1661714 [ dbSNP | Ensembl ].
VAR_050075
Natural varianti1001 – 10011G → S.
Corresponds to variant rs35886912 [ dbSNP | Ensembl ].
VAR_034059

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei346 – 35611TFDDPYALVVL → SRRASGVGAQG in isoform B.
VSP_047387Add
BLAST
Alternative sequencei357 – 1020664Missing in isoform B.
VSP_047388Add
BLAST
Alternative sequencei986 – 102035VLKEI…NGGAE → AATGVHIEPPWGAASAMAEQ SEWLSVQAAR in isoform A.
VSP_017946Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X87342 mRNA. Translation: CAA60780.1.
AC100787 Genomic DNA. No translation available.
BC006503 mRNA. Translation: AAH06503.1.
BC010879 mRNA. Translation: AAH10879.1.
BC064994 mRNA. Translation: AAH64994.1.
CCDSiCCDS11725.1. [Q6P1M3-2]
CCDS32733.1. [Q6P1M3-1]
CCDS45776.1. [Q6P1M3-3]
PIRiS55474.
RefSeqiNP_001015002.1. NM_001015002.1. [Q6P1M3-3]
NP_001026973.1. NM_001031803.1. [Q6P1M3-1]
NP_004515.2. NM_004524.2. [Q6P1M3-2]
UniGeneiHs.514477.

Genome annotation databases

EnsembliENST00000167462; ENSP00000167462; ENSG00000073350. [Q6P1M3-2]
ENST00000375227; ENSP00000364375; ENSG00000073350. [Q6P1M3-3]
ENST00000392550; ENSP00000376333; ENSG00000073350. [Q6P1M3-1]
ENST00000578363; ENSP00000464603; ENSG00000073350. [Q6P1M3-3]
GeneIDi3993.
KEGGihsa:3993.
UCSCiuc002jog.1. human. [Q6P1M3-3]
uc002joh.3. human. [Q6P1M3-1]
uc002joi.3. human. [Q6P1M3-2]

Polymorphism databases

DMDMi93204600.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X87342 mRNA. Translation: CAA60780.1 .
AC100787 Genomic DNA. No translation available.
BC006503 mRNA. Translation: AAH06503.1 .
BC010879 mRNA. Translation: AAH10879.1 .
BC064994 mRNA. Translation: AAH64994.1 .
CCDSi CCDS11725.1. [Q6P1M3-2 ]
CCDS32733.1. [Q6P1M3-1 ]
CCDS45776.1. [Q6P1M3-3 ]
PIRi S55474.
RefSeqi NP_001015002.1. NM_001015002.1. [Q6P1M3-3 ]
NP_001026973.1. NM_001031803.1. [Q6P1M3-1 ]
NP_004515.2. NM_004524.2. [Q6P1M3-2 ]
UniGenei Hs.514477.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
3WP0 X-ray 2.04 B 640-654 [» ]
3WP1 X-ray 2.80 A 646-657 [» ]
ProteinModelPortali Q6P1M3.
SMRi Q6P1M3. Positions 217-247, 589-621.
ModBasei Search...

Protein-protein interaction databases

BioGridi 110181. 6 interactions.
IntActi Q6P1M3. 5 interactions.
MINTi MINT-261325.
STRINGi 9606.ENSP00000376333.

PTM databases

PhosphoSitei Q6P1M3.

Polymorphism databases

DMDMi 93204600.

Proteomic databases

MaxQBi Q6P1M3.
PaxDbi Q6P1M3.
PRIDEi Q6P1M3.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000167462 ; ENSP00000167462 ; ENSG00000073350 . [Q6P1M3-2 ]
ENST00000375227 ; ENSP00000364375 ; ENSG00000073350 . [Q6P1M3-3 ]
ENST00000392550 ; ENSP00000376333 ; ENSG00000073350 . [Q6P1M3-1 ]
ENST00000578363 ; ENSP00000464603 ; ENSG00000073350 . [Q6P1M3-3 ]
GeneIDi 3993.
KEGGi hsa:3993.
UCSCi uc002jog.1. human. [Q6P1M3-3 ]
uc002joh.3. human. [Q6P1M3-1 ]
uc002joi.3. human. [Q6P1M3-2 ]

Organism-specific databases

CTDi 3993.
GeneCardsi GC17P073521.
HGNCi HGNC:6629. LLGL2.
HPAi HPA022913.
neXtProti NX_Q6P1M3.
PharmGKBi PA30397.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG289584.
HOGENOMi HOG000115700.
HOVERGENi HBG052711.
InParanoidi Q6P1M3.
KOi K06094.
OMAi QCQPPAV.
OrthoDBi EOG79W94C.
PhylomeDBi Q6P1M3.
TreeFami TF314585.

Enzyme and pathway databases

SignaLinki Q6P1M3.

Miscellaneous databases

ChiTaRSi LLGL2. human.
GenomeRNAii 3993.
NextBioi 15664.
PROi Q6P1M3.

Gene expression databases

ArrayExpressi Q6P1M3.
Bgeei Q6P1M3.
CleanExi HS_LLGL2.
Genevestigatori Q6P1M3.

Family and domain databases

Gene3Di 2.130.10.10. 3 hits.
InterProi IPR000664. Lethal2_giant.
IPR013577. LLGL2.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view ]
Pfami PF08366. LLGL. 1 hit.
PF00400. WD40. 1 hit.
[Graphical view ]
PRINTSi PR00962. LETHAL2GIANT.
SMARTi SM00320. WD40. 5 hits.
[Graphical view ]
SUPFAMi SSF50978. SSF50978. 5 hits.
PROSITEi PS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A human homolog of the Drosophila 1(2) giant larvae tumor suppressor maps to 17q24-25."
    Wiemann S., Tommerup N., Celis J.E., Ansorge W., Leffers H.
    Submitted (MAY-1995) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM C), VARIANT HIS-45.
  2. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS A AND B), VARIANTS LEU-479 AND SER-759.
    Tissue: Lung and Testis.
  4. "Direct binding of Lgl2 to LGN during mitosis and its requirement for normal cell division."
    Yasumi M., Sakisaka T., Hoshino T., Kimura T., Sakamoto Y., Yamanaka T., Ohno S., Takai Y.
    J. Biol. Chem. 280:6761-6765(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH GPSM2/LGN, SUBCELLULAR LOCATION, FUNCTION.
    Tissue: Brain.
  5. "Mammalian Lgl forms a protein complex with PAR-6 and aPKC independently of PAR-3 to regulate epithelial cell polarity."
    Yamanaka T., Horikoshi Y., Sugiyama Y., Ishiyama C., Suzuki A., Hirose T., Iwamatsu A., Shinohara A., Ohno S.
    Curr. Biol. 13:734-743(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH PARD6B/PAR-6 AND PRKCI/APKC, PHOSPHORYLATION AT SER-653, MUTAGENESIS OF SER-641; SER-645; SER-649; SER-653; SER-660 AND SER-663.
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1015, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. Cited for: INTERACTION WITH VPRBP.
  8. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiL2GL2_HUMAN
AccessioniPrimary (citable) accession number: Q6P1M3
Secondary accession number(s): Q14521, Q9BR62
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 18, 2006
Last sequence update: April 18, 2006
Last modified: July 9, 2014
This is version 100 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Overexpression of LLGL2 inhibits the tight junction formation.

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi