Q6P1M3 (L2GL2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 87.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Lethal(2) giant larvae protein homolog 2 Alternative name(s): HGL | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1020 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Part of a complex with GPSM2/LGN, PRKCI/aPKC and PARD6B/Par-6, which may ensure the correct organization and orientation of bipolar spindles for normal cell division. This complex plays roles in the initial phase of the establishment of epithelial cell polarity. Ref.4 |
| Subunit structure | Interacts with GPSM2/LGN, PRKCI/aPKC and PARD6B/Par-6. The complex is enhanced during mitosis. Ref.4 Ref.5 |
| Subcellular location | Cytoplasm. Note: Localized in the perinuclear structure and faintly at the cell-cell contacts sites in the interphase. Localized at the cell periphery during metaphase. Cortical localization in mitotic cells. Found in the lateral region of polarized epithelial cells. Ref.4 |
| Post-translational modification | Phosphorylated at Ser-653 by PRKCI. Phosphorylation is enhanced during cell polarization induced by calcium. Phosphorylation may occur during the cell-cell contact-induced cell polarization and may contribute to the segregation of LLGL2 from the PRKCI/aPKC and PARD6B/Par-6 complex. Ref.5 |
| Miscellaneous | Overexpression of LLGL2 inhibits the tight junction formation. |
| Sequence similarities | Belongs to the WD repeat L(2)GL family. Contains 14 WD repeats. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell cycle Cell division Exocytosis |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat WD repeat |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell cycle Inferred from electronic annotation. Source: UniProtKB-KW cell divisionInferred from electronic annotation. Source: UniProtKB-KW exocytosisInferred from electronic annotation. Source: UniProtKB-KW regulation of establishment or maintenance of cell polarityInferred from direct assay Ref.5. Source: UniProtKB |
| Cellular_component | cytoplasm Inferred from direct assay Ref.4. Source: UniProtKB intracellular membrane-bounded organelleInferred from direct assay. Source: HPA |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform C (identifier: Q6P1M3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform A (identifier: Q6P1M3-2) The sequence of this isoform differs from the canonical sequence as follows: 986-1020: VLKEIQSTLEGDRGSGNWRSHRAAVGCSLSNGGAE → AATGVHIEPPWGAASAMAEQSEWLSVQAAR | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform B (identifier: Q6P1M3-3) The sequence of this isoform differs from the canonical sequence as follows: 346-351: TFDDPY → SGVGAQ 352-1020: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1020 | 1020 | Lethal(2) giant larvae protein homolog 2 | PRO_0000232728 | |||||
Regions | |||||||||
| Repeat | 36 – 69 | 34 | WD 1 | ||||||
| Repeat | 76 – 117 | 42 | WD 2 | ||||||
| Repeat | 132 – 169 | 38 | WD 3 | ||||||
| Repeat | 193 – 227 | 35 | WD 4 | ||||||
| Repeat | 233 – 268 | 36 | WD 5 | ||||||
| Repeat | 282 – 324 | 43 | WD 6 | ||||||
| Repeat | 332 – 366 | 35 | WD 7 | ||||||
| Repeat | 388 – 464 | 77 | WD 8 | ||||||
| Repeat | 508 – 583 | 76 | WD 9 | ||||||
| Repeat | 592 – 653 | 62 | WD 10 | ||||||
| Repeat | 713 – 769 | 57 | WD 11 | ||||||
| Repeat | 778 – 830 | 53 | WD 12 | ||||||
| Repeat | 835 – 888 | 54 | WD 13 | ||||||
| Repeat | 902 – 925 | 24 | WD 14 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 653 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 1015 | 1 | Phosphoserine Ref.6 | ||||||
Natural variations | |||||||||
| Alternative sequence | 346 – 351 | 6 | TFDDPY → SGVGAQ in isoform B. | VSP_017944 | |||||
| Alternative sequence | 352 – 1020 | 669 | Missing in isoform B. | VSP_017945 | |||||
| Alternative sequence | 986 – 1020 | 35 | VLKEI…NGGAE → AATGVHIEPPWGAASAMAEQ SEWLSVQAAR in isoform A. | VSP_017946 | |||||
| Natural variant | 45 | 1 | R → H. Ref.1 Corresponds to variant rs1671036 [ dbSNP | Ensembl ]. | VAR_050069 | |||||
| Natural variant | 479 | 1 | F → L. Ref.3 Corresponds to variant rs1671021 [ dbSNP | Ensembl ]. | VAR_050070 | |||||
| Natural variant | 488 | 1 | P → L. Corresponds to variant rs35991442 [ dbSNP | Ensembl ]. | VAR_050071 | |||||
| Natural variant | 490 | 1 | L → P. Corresponds to variant rs1671021 [ dbSNP | Ensembl ]. | VAR_050072 | |||||
| Natural variant | 748 | 1 | R → H. Corresponds to variant rs35474687 [ dbSNP | Ensembl ]. | VAR_034058 | |||||
| Natural variant | 759 | 1 | P → S. Ref.3 Corresponds to variant rs1661715 [ dbSNP | Ensembl ]. | VAR_050073 | |||||
| Natural variant | 790 | 1 | P → L. Corresponds to variant rs1661714 [ dbSNP | Ensembl ]. | VAR_050075 | |||||
| Natural variant | 1001 | 1 | G → S. Corresponds to variant rs35886912 [ dbSNP | Ensembl ]. | VAR_034059 | |||||
Experimental info | |||||||||
| Mutagenesis | 641 | 1 | S → A: No effect on phosphorylation. Ref.5 | ||||||
| Mutagenesis | 645 | 1 | S → A: Decrease of phosphorylation. Ref.5 | ||||||
| Mutagenesis | 649 | 1 | S → A: Decrease of phosphorylation. Ref.5 | ||||||
| Mutagenesis | 653 | 1 | S → A: Loss of phosphorylation. Ref.5 | ||||||
| Mutagenesis | 660 | 1 | S → A: Decrease of phosphorylation. Ref.5 | ||||||
| Mutagenesis | 663 | 1 | S → A: No effect on phosphorylation. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A human homolog of the Drosophila 1(2) giant larvae tumor suppressor maps to 17q24-25." Wiemann S., Tommerup N., Celis J.E., Ansorge W., Leffers H. Submitted (MAY-1995) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM C), VARIANT HIS-45. |
| [2] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS A AND B), VARIANTS LEU-479 AND SER-759. Tissue: Lung and Testis. |
| [4] | "Direct binding of Lgl2 to LGN during mitosis and its requirement for normal cell division." Yasumi M., Sakisaka T., Hoshino T., Kimura T., Sakamoto Y., Yamanaka T., Ohno S., Takai Y. J. Biol. Chem. 280:6761-6765(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH GPSM2/LGN, SUBCELLULAR LOCATION, FUNCTION. Tissue: Brain. |
| [5] | "Mammalian Lgl forms a protein complex with PAR-6 and aPKC independently of PAR-3 to regulate epithelial cell polarity." Yamanaka T., Horikoshi Y., Sugiyama Y., Ishiyama C., Suzuki A., Hirose T., Iwamatsu A., Shinohara A., Ohno S. Curr. Biol. 13:734-743(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PARD6B/PAR-6 AND PRKCI/APKC, PHOSPHORYLATION AT SER-653, MUTAGENESIS OF SER-641; SER-645; SER-649; SER-653; SER-660 AND SER-663. |
| [6] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1015, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [7] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X87342 mRNA. Translation: CAA60780.1. AC100787 Genomic DNA. No translation available. BC006503 mRNA. Translation: AAH06503.1. BC010879 mRNA. Translation: AAH10879.1. BC064994 mRNA. Translation: AAH64994.1. |
| IPI | IPI00465050. IPI00555972. IPI00641801. |
| PIR | S55474. |
| RefSeq | NP_001015002.1. NM_001015002.1. NP_001026973.1. NM_001031803.1. NP_004515.2. NM_004524.2. |
| UniGene | Hs.514477. |
3D structure databases | |
| ProteinModelPortal | Q6P1M3. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q6P1M3. 4 interactions. |
| STRING | 9606.ENSP00000376333. |
PTM databases | |
| PhosphoSite | Q6P1M3. |
Polymorphism databases | |
| DMDM | 93204600. |
Proteomic databases | |
| PaxDb | Q6P1M3. |
| PRIDE | Q6P1M3. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000167462; ENSP00000167462; ENSG00000073350. ENST00000375227; ENSP00000364375; ENSG00000073350. ENST00000392550; ENSP00000376333; ENSG00000073350. ENST00000578363; ENSP00000464603; ENSG00000073350. |
| GeneID | 3993. |
| KEGG | hsa:3993. |
| UCSC | uc002jog.1. human. uc002joh.3. human. uc002joi.3. human. |
Organism-specific databases | |
| CTD | 3993. |
| GeneCards | GC17P073521. |
| HGNC | HGNC:6629. LLGL2. |
| HPA | HPA022913. |
| neXtProt | NX_Q6P1M3. |
| PharmGKB | PA30397. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG289584. |
| HOGENOM | HOG000115700. |
| HOVERGEN | HBG052711. |
| InParanoid | Q6P1M3. |
| KO | K06094. |
| OMA | QCQPPAV. |
Gene expression databases | |
| ArrayExpress | Q6P1M3. |
| Bgee | Q6P1M3. |
| CleanEx | HS_LLGL2. |
| Genevestigator | Q6P1M3. |
| GermOnline | ENSG00000073350. Homo sapiens. |
Family and domain databases | |
| Gene3D | 2.130.10.10. 3 hits. |
| InterPro | IPR000664. Lethal2_giant. IPR013577. LLGL2. IPR015943. WD40/YVTN_repeat-like_dom. IPR001680. WD40_repeat. IPR019775. WD40_repeat_CS. IPR017986. WD40_repeat_dom. [Graphical view] |
| Pfam | PF08366. LLGL. 1 hit. PF00400. WD40. 1 hit. [Graphical view] |
| PRINTS | PR00962. LETHAL2GIANT. |
| SMART | SM00320. WD40. 5 hits. [Graphical view] |
| SUPFAM | SSF50978. WD40_like. 1 hit. |
| PROSITE | PS00678. WD_REPEATS_1. 1 hit. PS50082. WD_REPEATS_2. 1 hit. PS50294. WD_REPEATS_REGION. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | LLGL2. human. |
| GenomeRNAi | 3993. |
| NextBio | 15664. |
Entry information
| Entry name | L2GL2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6P1M3 Secondary accession number(s): Q14521, Q9BR62 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
