Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6P1M3

- L2GL2_HUMAN

UniProt

Q6P1M3 - L2GL2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Lethal(2) giant larvae protein homolog 2

Gene

LLGL2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Part of a complex with GPSM2/LGN, PRKCI/aPKC and PARD6B/Par-6, which may ensure the correct organization and orientation of bipolar spindles for normal cell division. This complex plays roles in the initial phase of the establishment of epithelial cell polarity.1 Publication

GO - Molecular functioni

  1. PDZ domain binding Source: UniProtKB

GO - Biological processi

  1. cell cycle Source: UniProtKB-KW
  2. cell division Source: UniProtKB-KW
  3. exocytosis Source: UniProtKB-KW
  4. regulation of establishment or maintenance of cell polarity Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Cell cycle, Cell division, Exocytosis

Enzyme and pathway databases

SignaLinkiQ6P1M3.

Names & Taxonomyi

Protein namesi
Recommended name:
Lethal(2) giant larvae protein homolog 2
Alternative name(s):
HGL
Gene namesi
Name:LLGL2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Unplaced

Organism-specific databases

HGNCiHGNC:6629. LLGL2.

Subcellular locationi

Cytoplasm 1 Publication
Note: Localized in the perinuclear structure and faintly at the cell-cell contacts sites in the interphase. Localized at the cell periphery during metaphase. Cortical localization in mitotic cells. Found in the lateral region of polarized epithelial cells.

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi641 – 6411S → A: No effect on phosphorylation. 1 Publication
Mutagenesisi645 – 6451S → A: Decrease of phosphorylation. 1 Publication
Mutagenesisi649 – 6491S → A: Decrease of phosphorylation. 1 Publication
Mutagenesisi653 – 6531S → A: Loss of phosphorylation. 1 Publication
Mutagenesisi660 – 6601S → A: Decrease of phosphorylation. 1 Publication
Mutagenesisi663 – 6631S → A: No effect on phosphorylation. 1 Publication

Organism-specific databases

PharmGKBiPA30397.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10201020Lethal(2) giant larvae protein homolog 2PRO_0000232728Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei653 – 6531Phosphoserine1 Publication
Modified residuei1015 – 10151Phosphoserine1 Publication

Post-translational modificationi

Phosphorylated at Ser-653 by PRKCI. Phosphorylation is enhanced during cell polarization induced by calcium. Phosphorylation may occur during the cell-cell contact-induced cell polarization and may contribute to the segregation of LLGL2 from the PRKCI/aPKC and PARD6B/Par-6 complex.2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ6P1M3.
PaxDbiQ6P1M3.
PRIDEiQ6P1M3.

PTM databases

PhosphoSiteiQ6P1M3.

Expressioni

Gene expression databases

BgeeiQ6P1M3.
CleanExiHS_LLGL2.
ExpressionAtlasiQ6P1M3. baseline and differential.
GenevestigatoriQ6P1M3.

Organism-specific databases

HPAiHPA022913.

Interactioni

Subunit structurei

Interacts with GPSM2/LGN, PRKCI/aPKC and PARD6B/Par-6. The complex is enhanced during mitosis. Interacts with VPRBP.3 Publications

Protein-protein interaction databases

BioGridi110181. 7 interactions.
IntActiQ6P1M3. 5 interactions.
MINTiMINT-261325.
STRINGi9606.ENSP00000376333.

Structurei

Secondary structure

1
1020
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi645 – 6495Combined sources
Helixi652 – 6565Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3WP0X-ray2.04B640-654[»]
3WP1X-ray2.80A646-657[»]
ProteinModelPortaliQ6P1M3.
SMRiQ6P1M3. Positions 217-247, 589-621.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati36 – 6934WD 1Add
BLAST
Repeati76 – 11742WD 2Add
BLAST
Repeati132 – 16938WD 3Add
BLAST
Repeati193 – 22735WD 4Add
BLAST
Repeati233 – 26836WD 5Add
BLAST
Repeati282 – 32443WD 6Add
BLAST
Repeati332 – 36635WD 7Add
BLAST
Repeati388 – 46477WD 8Add
BLAST
Repeati508 – 58376WD 9Add
BLAST
Repeati592 – 65362WD 10Add
BLAST
Repeati713 – 76957WD 11Add
BLAST
Repeati778 – 83053WD 12Add
BLAST
Repeati835 – 88854WD 13Add
BLAST
Repeati902 – 92524WD 14Add
BLAST

Sequence similaritiesi

Belongs to the WD repeat L(2)GL family.Curated
Contains 14 WD repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiNOG289584.
GeneTreeiENSGT00390000000018.
HOGENOMiHOG000115700.
HOVERGENiHBG052711.
InParanoidiQ6P1M3.
KOiK06094.
OMAiQCQPPAV.
OrthoDBiEOG79W94C.
PhylomeDBiQ6P1M3.
TreeFamiTF314585.

Family and domain databases

Gene3Di2.130.10.10. 3 hits.
InterProiIPR000664. Lethal2_giant.
IPR013577. LLGL2.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF08366. LLGL. 1 hit.
PF00400. WD40. 1 hit.
[Graphical view]
PRINTSiPR00962. LETHAL2GIANT.
SMARTiSM00320. WD40. 5 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 5 hits.
PROSITEiPS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform C (identifier: Q6P1M3-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRRFLRPGHD PVRERLKRDL FQFNKTVEHG FPHQPSALGY SPSLRILAIG
60 70 80 90 100
TRSGAIKLYG APGVEFMGLH QENNAVTQIH LLPGQCQLVT LLDDNSLHLW
110 120 130 140 150
SLKVKGGASE LQEDESFTLR GPPGAAPSAT QITVVLPHSS CELLYLGTES
160 170 180 190 200
GNVFVVQLPA FRALEDRTIS SDAVLQRLPE EARHRRVFEM VEALQEHPRD
210 220 230 240 250
PNQILIGYSR GLVVIWDLQG SRVLYHFLSS QQLENIWWQR DGRLLVSCHS
260 270 280 290 300
DGSYCQWPVS SEAQQPEPLR SLVPYGPFPC KAITRILWLT TRQGLPFTIF
310 320 330 340 350
QGGMPRASYG DRHCISVIHD GQQTAFDFTS RVIGFTVLTE ADPAATFDDP
360 370 380 390 400
YALVVLAEEE LVVIDLQTAG WPPVQLPYLA SLHCSAITCS HHVSNIPLKL
410 420 430 440 450
WERIIAAGSR QNAHFSTMEW PIDGGTSLTP APPQRDLLLT GHEDGTVRFW
460 470 480 490 500
DASGVCLRLL YKLSTVRVFL TDTDPNENFS AQGEDEWPPL RKVGSFDPYS
510 520 530 540 550
DDPRLGIQKI FLCKYSGYLA VAGTAGQVLV LELNDEAAEQ AVEQVEADLL
560 570 580 590 600
QDQEGYRWKG HERLAARSGP VRFEPGFQPF VLVQCQPPAV VTSLALHSEW
610 620 630 640 650
RLVAFGTSHG FGLFDHQQRR QVFVKCTLHP SDQLALEGPL SRVKSLKKSL
660 670 680 690 700
RQSFRRMRRS RVSSRKRHPA GPPGEAQEGS AKAERPGLQN MELAPVQRKI
710 720 730 740 750
EARSAEDSFT GFVRTLYFAD TYLKDSSRHC PSLWAGTNGG TIYAFSLRVP
760 770 780 790 800
PAERRMDEPV RAEQAKEIQL MHRAPVVGIL VLDGHSVPLP EPLEVAHDLS
810 820 830 840 850
KSPDMQGSHQ LLVVSEEQFK VFTLPKVSAK LKLKLTALEG SRVRRVSVAH
860 870 880 890 900
FGSRRAEDYG EHHLAVLTNL GDIQVVSLPL LKPQVRYSCI RREDVSGIAS
910 920 930 940 950
CVFTKYGQGF YLISPSEFER FSLSTKWLVE PRCLVDSAET KNHRPGNGAG
960 970 980 990 1000
PKKAPSRARN SGTQSDGEEK QPGLVMERAL LSDERVLKEI QSTLEGDRGS
1010 1020
GNWRSHRAAV GCSLSNGGAE
Length:1,020
Mass (Da):113,448
Last modified:April 18, 2006 - v2
Checksum:i9C36BFF9F94314B5
GO
Isoform A (identifier: Q6P1M3-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     986-1020: VLKEIQSTLEGDRGSGNWRSHRAAVGCSLSNGGAE → AATGVHIEPPWGAASAMAEQSEWLSVQAAR

Note: No experimental confirmation available.

Show »
Length:1,015
Mass (Da):112,927
Checksum:iF2C96A62BAA08AE4
GO
Isoform B (identifier: Q6P1M3-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     346-356: TFDDPYALVVL → SRRASGVGAQG
     357-1020: Missing.

Note: No experimental confirmation available.

Show »
Length:356
Mass (Da):39,668
Checksum:i0A6C67EDFB69D544
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti45 – 451R → H.1 Publication
Corresponds to variant rs1671036 [ dbSNP | Ensembl ].
VAR_050069
Natural varianti479 – 4791F → L.1 Publication
Corresponds to variant rs1671021 [ dbSNP | Ensembl ].
VAR_050070
Natural varianti488 – 4881P → L.
Corresponds to variant rs35991442 [ dbSNP | Ensembl ].
VAR_050071
Natural varianti490 – 4901L → P.
Corresponds to variant rs1671021 [ dbSNP | Ensembl ].
VAR_050072
Natural varianti748 – 7481R → H.
Corresponds to variant rs35474687 [ dbSNP | Ensembl ].
VAR_034058
Natural varianti759 – 7591P → S.1 Publication
Corresponds to variant rs1661715 [ dbSNP | Ensembl ].
VAR_050073
Natural varianti790 – 7901P → L.
Corresponds to variant rs1661714 [ dbSNP | Ensembl ].
VAR_050075
Natural varianti1001 – 10011G → S.
Corresponds to variant rs35886912 [ dbSNP | Ensembl ].
VAR_034059

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei346 – 35611TFDDPYALVVL → SRRASGVGAQG in isoform B. 1 PublicationVSP_047387Add
BLAST
Alternative sequencei357 – 1020664Missing in isoform B. 1 PublicationVSP_047388Add
BLAST
Alternative sequencei986 – 102035VLKEI…NGGAE → AATGVHIEPPWGAASAMAEQ SEWLSVQAAR in isoform A. 1 PublicationVSP_017946Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X87342 mRNA. Translation: CAA60780.1.
AC100787 Genomic DNA. No translation available.
BC006503 mRNA. Translation: AAH06503.1.
BC010879 mRNA. Translation: AAH10879.1.
BC064994 mRNA. Translation: AAH64994.1.
CCDSiCCDS11725.1. [Q6P1M3-2]
CCDS32733.1. [Q6P1M3-1]
CCDS45776.1. [Q6P1M3-3]
PIRiS55474.
RefSeqiNP_001015002.1. NM_001015002.1. [Q6P1M3-3]
NP_001026973.1. NM_001031803.1. [Q6P1M3-1]
NP_004515.2. NM_004524.2. [Q6P1M3-2]
UniGeneiHs.514477.

Genome annotation databases

EnsembliENST00000167462; ENSP00000167462; ENSG00000073350. [Q6P1M3-2]
ENST00000375227; ENSP00000364375; ENSG00000073350. [Q6P1M3-3]
ENST00000392550; ENSP00000376333; ENSG00000073350. [Q6P1M3-1]
ENST00000578363; ENSP00000464603; ENSG00000073350. [Q6P1M3-3]
GeneIDi3993.
KEGGihsa:3993.
UCSCiuc002jog.1. human. [Q6P1M3-3]
uc002joh.3. human. [Q6P1M3-1]
uc002joi.3. human. [Q6P1M3-2]

Polymorphism databases

DMDMi93204600.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X87342 mRNA. Translation: CAA60780.1 .
AC100787 Genomic DNA. No translation available.
BC006503 mRNA. Translation: AAH06503.1 .
BC010879 mRNA. Translation: AAH10879.1 .
BC064994 mRNA. Translation: AAH64994.1 .
CCDSi CCDS11725.1. [Q6P1M3-2 ]
CCDS32733.1. [Q6P1M3-1 ]
CCDS45776.1. [Q6P1M3-3 ]
PIRi S55474.
RefSeqi NP_001015002.1. NM_001015002.1. [Q6P1M3-3 ]
NP_001026973.1. NM_001031803.1. [Q6P1M3-1 ]
NP_004515.2. NM_004524.2. [Q6P1M3-2 ]
UniGenei Hs.514477.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
3WP0 X-ray 2.04 B 640-654 [» ]
3WP1 X-ray 2.80 A 646-657 [» ]
ProteinModelPortali Q6P1M3.
SMRi Q6P1M3. Positions 217-247, 589-621.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 110181. 7 interactions.
IntActi Q6P1M3. 5 interactions.
MINTi MINT-261325.
STRINGi 9606.ENSP00000376333.

PTM databases

PhosphoSitei Q6P1M3.

Polymorphism databases

DMDMi 93204600.

Proteomic databases

MaxQBi Q6P1M3.
PaxDbi Q6P1M3.
PRIDEi Q6P1M3.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000167462 ; ENSP00000167462 ; ENSG00000073350 . [Q6P1M3-2 ]
ENST00000375227 ; ENSP00000364375 ; ENSG00000073350 . [Q6P1M3-3 ]
ENST00000392550 ; ENSP00000376333 ; ENSG00000073350 . [Q6P1M3-1 ]
ENST00000578363 ; ENSP00000464603 ; ENSG00000073350 . [Q6P1M3-3 ]
GeneIDi 3993.
KEGGi hsa:3993.
UCSCi uc002jog.1. human. [Q6P1M3-3 ]
uc002joh.3. human. [Q6P1M3-1 ]
uc002joi.3. human. [Q6P1M3-2 ]

Organism-specific databases

CTDi 3993.
GeneCardsi GC17P073521.
HGNCi HGNC:6629. LLGL2.
HPAi HPA022913.
neXtProti NX_Q6P1M3.
PharmGKBi PA30397.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG289584.
GeneTreei ENSGT00390000000018.
HOGENOMi HOG000115700.
HOVERGENi HBG052711.
InParanoidi Q6P1M3.
KOi K06094.
OMAi QCQPPAV.
OrthoDBi EOG79W94C.
PhylomeDBi Q6P1M3.
TreeFami TF314585.

Enzyme and pathway databases

SignaLinki Q6P1M3.

Miscellaneous databases

ChiTaRSi LLGL2. human.
GenomeRNAii 3993.
NextBioi 15664.
PROi Q6P1M3.

Gene expression databases

Bgeei Q6P1M3.
CleanExi HS_LLGL2.
ExpressionAtlasi Q6P1M3. baseline and differential.
Genevestigatori Q6P1M3.

Family and domain databases

Gene3Di 2.130.10.10. 3 hits.
InterProi IPR000664. Lethal2_giant.
IPR013577. LLGL2.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view ]
Pfami PF08366. LLGL. 1 hit.
PF00400. WD40. 1 hit.
[Graphical view ]
PRINTSi PR00962. LETHAL2GIANT.
SMARTi SM00320. WD40. 5 hits.
[Graphical view ]
SUPFAMi SSF50978. SSF50978. 5 hits.
PROSITEi PS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A human homolog of the Drosophila 1(2) giant larvae tumor suppressor maps to 17q24-25."
    Wiemann S., Tommerup N., Celis J.E., Ansorge W., Leffers H.
    Submitted (MAY-1995) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM C), VARIANT HIS-45.
  2. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS A AND B), VARIANTS LEU-479 AND SER-759.
    Tissue: Lung and Testis.
  4. "Direct binding of Lgl2 to LGN during mitosis and its requirement for normal cell division."
    Yasumi M., Sakisaka T., Hoshino T., Kimura T., Sakamoto Y., Yamanaka T., Ohno S., Takai Y.
    J. Biol. Chem. 280:6761-6765(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH GPSM2/LGN, SUBCELLULAR LOCATION, FUNCTION.
    Tissue: Brain.
  5. "Mammalian Lgl forms a protein complex with PAR-6 and aPKC independently of PAR-3 to regulate epithelial cell polarity."
    Yamanaka T., Horikoshi Y., Sugiyama Y., Ishiyama C., Suzuki A., Hirose T., Iwamatsu A., Shinohara A., Ohno S.
    Curr. Biol. 13:734-743(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH PARD6B/PAR-6 AND PRKCI/APKC, PHOSPHORYLATION AT SER-653, MUTAGENESIS OF SER-641; SER-645; SER-649; SER-653; SER-660 AND SER-663.
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1015, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. Cited for: INTERACTION WITH VPRBP.
  8. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiL2GL2_HUMAN
AccessioniPrimary (citable) accession number: Q6P1M3
Secondary accession number(s): Q14521, Q9BR62
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 18, 2006
Last sequence update: April 18, 2006
Last modified: November 26, 2014
This is version 103 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Overexpression of LLGL2 inhibits the tight junction formation.

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3