Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q6P1M3 (L2GL2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 100. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Lethal(2) giant larvae protein homolog 2
Alternative name(s):
HGL
Gene names
Name:LLGL2
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1020 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Part of a complex with GPSM2/LGN, PRKCI/aPKC and PARD6B/Par-6, which may ensure the correct organization and orientation of bipolar spindles for normal cell division. This complex plays roles in the initial phase of the establishment of epithelial cell polarity. Ref.4

Subunit structure

Interacts with GPSM2/LGN, PRKCI/aPKC and PARD6B/Par-6. The complex is enhanced during mitosis. Interacts with VPRBP. Ref.4 Ref.5 Ref.7

Subcellular location

Cytoplasm. Note: Localized in the perinuclear structure and faintly at the cell-cell contacts sites in the interphase. Localized at the cell periphery during metaphase. Cortical localization in mitotic cells. Found in the lateral region of polarized epithelial cells. Ref.4

Post-translational modification

Phosphorylated at Ser-653 by PRKCI. Phosphorylation is enhanced during cell polarization induced by calcium. Phosphorylation may occur during the cell-cell contact-induced cell polarization and may contribute to the segregation of LLGL2 from the PRKCI/aPKC and PARD6B/Par-6 complex. Ref.5

Miscellaneous

Overexpression of LLGL2 inhibits the tight junction formation.

Sequence similarities

Belongs to the WD repeat L(2)GL family.

Contains 14 WD repeats.

Ontologies

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform C (identifier: Q6P1M3-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform A (identifier: Q6P1M3-2)

The sequence of this isoform differs from the canonical sequence as follows:
     986-1020: VLKEIQSTLEGDRGSGNWRSHRAAVGCSLSNGGAE → AATGVHIEPPWGAASAMAEQSEWLSVQAAR
Note: No experimental confirmation available.
Isoform B (identifier: Q6P1M3-3)

The sequence of this isoform differs from the canonical sequence as follows:
     346-356: TFDDPYALVVL → SRRASGVGAQG
     357-1020: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 10201020Lethal(2) giant larvae protein homolog 2
PRO_0000232728

Regions

Repeat36 – 6934WD 1
Repeat76 – 11742WD 2
Repeat132 – 16938WD 3
Repeat193 – 22735WD 4
Repeat233 – 26836WD 5
Repeat282 – 32443WD 6
Repeat332 – 36635WD 7
Repeat388 – 46477WD 8
Repeat508 – 58376WD 9
Repeat592 – 65362WD 10
Repeat713 – 76957WD 11
Repeat778 – 83053WD 12
Repeat835 – 88854WD 13
Repeat902 – 92524WD 14

Amino acid modifications

Modified residue6531Phosphoserine Ref.5
Modified residue10151Phosphoserine Ref.6

Natural variations

Alternative sequence346 – 35611TFDDPYALVVL → SRRASGVGAQG in isoform B.
VSP_047387
Alternative sequence357 – 1020664Missing in isoform B.
VSP_047388
Alternative sequence986 – 102035VLKEI…NGGAE → AATGVHIEPPWGAASAMAEQ SEWLSVQAAR in isoform A.
VSP_017946
Natural variant451R → H. Ref.1
Corresponds to variant rs1671036 [ dbSNP | Ensembl ].
VAR_050069
Natural variant4791F → L. Ref.3
Corresponds to variant rs1671021 [ dbSNP | Ensembl ].
VAR_050070
Natural variant4881P → L.
Corresponds to variant rs35991442 [ dbSNP | Ensembl ].
VAR_050071
Natural variant4901L → P.
Corresponds to variant rs1671021 [ dbSNP | Ensembl ].
VAR_050072
Natural variant7481R → H.
Corresponds to variant rs35474687 [ dbSNP | Ensembl ].
VAR_034058
Natural variant7591P → S. Ref.3
Corresponds to variant rs1661715 [ dbSNP | Ensembl ].
VAR_050073
Natural variant7901P → L.
Corresponds to variant rs1661714 [ dbSNP | Ensembl ].
VAR_050075
Natural variant10011G → S.
Corresponds to variant rs35886912 [ dbSNP | Ensembl ].
VAR_034059

Experimental info

Mutagenesis6411S → A: No effect on phosphorylation. Ref.5
Mutagenesis6451S → A: Decrease of phosphorylation. Ref.5
Mutagenesis6491S → A: Decrease of phosphorylation. Ref.5
Mutagenesis6531S → A: Loss of phosphorylation. Ref.5
Mutagenesis6601S → A: Decrease of phosphorylation. Ref.5
Mutagenesis6631S → A: No effect on phosphorylation. Ref.5

Secondary structure

... 1020
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform C [UniParc].

Last modified April 18, 2006. Version 2.
Checksum: 9C36BFF9F94314B5

FASTA1,020113,448
        10         20         30         40         50         60 
MRRFLRPGHD PVRERLKRDL FQFNKTVEHG FPHQPSALGY SPSLRILAIG TRSGAIKLYG 

        70         80         90        100        110        120 
APGVEFMGLH QENNAVTQIH LLPGQCQLVT LLDDNSLHLW SLKVKGGASE LQEDESFTLR 

       130        140        150        160        170        180 
GPPGAAPSAT QITVVLPHSS CELLYLGTES GNVFVVQLPA FRALEDRTIS SDAVLQRLPE 

       190        200        210        220        230        240 
EARHRRVFEM VEALQEHPRD PNQILIGYSR GLVVIWDLQG SRVLYHFLSS QQLENIWWQR 

       250        260        270        280        290        300 
DGRLLVSCHS DGSYCQWPVS SEAQQPEPLR SLVPYGPFPC KAITRILWLT TRQGLPFTIF 

       310        320        330        340        350        360 
QGGMPRASYG DRHCISVIHD GQQTAFDFTS RVIGFTVLTE ADPAATFDDP YALVVLAEEE 

       370        380        390        400        410        420 
LVVIDLQTAG WPPVQLPYLA SLHCSAITCS HHVSNIPLKL WERIIAAGSR QNAHFSTMEW 

       430        440        450        460        470        480 
PIDGGTSLTP APPQRDLLLT GHEDGTVRFW DASGVCLRLL YKLSTVRVFL TDTDPNENFS 

       490        500        510        520        530        540 
AQGEDEWPPL RKVGSFDPYS DDPRLGIQKI FLCKYSGYLA VAGTAGQVLV LELNDEAAEQ 

       550        560        570        580        590        600 
AVEQVEADLL QDQEGYRWKG HERLAARSGP VRFEPGFQPF VLVQCQPPAV VTSLALHSEW 

       610        620        630        640        650        660 
RLVAFGTSHG FGLFDHQQRR QVFVKCTLHP SDQLALEGPL SRVKSLKKSL RQSFRRMRRS 

       670        680        690        700        710        720 
RVSSRKRHPA GPPGEAQEGS AKAERPGLQN MELAPVQRKI EARSAEDSFT GFVRTLYFAD 

       730        740        750        760        770        780 
TYLKDSSRHC PSLWAGTNGG TIYAFSLRVP PAERRMDEPV RAEQAKEIQL MHRAPVVGIL 

       790        800        810        820        830        840 
VLDGHSVPLP EPLEVAHDLS KSPDMQGSHQ LLVVSEEQFK VFTLPKVSAK LKLKLTALEG 

       850        860        870        880        890        900 
SRVRRVSVAH FGSRRAEDYG EHHLAVLTNL GDIQVVSLPL LKPQVRYSCI RREDVSGIAS 

       910        920        930        940        950        960 
CVFTKYGQGF YLISPSEFER FSLSTKWLVE PRCLVDSAET KNHRPGNGAG PKKAPSRARN 

       970        980        990       1000       1010       1020 
SGTQSDGEEK QPGLVMERAL LSDERVLKEI QSTLEGDRGS GNWRSHRAAV GCSLSNGGAE 

« Hide

Isoform A [UniParc].

Checksum: F2C96A62BAA08AE4
Show »

FASTA1,015112,927
Isoform B [UniParc].

Checksum: 0A6C67EDFB69D544
Show »

FASTA35639,668

References

« Hide 'large scale' references
[1]"A human homolog of the Drosophila 1(2) giant larvae tumor suppressor maps to 17q24-25."
Wiemann S., Tommerup N., Celis J.E., Ansorge W., Leffers H.
Submitted (MAY-1995) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM C), VARIANT HIS-45.
[2]"DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. expand/collapse author list , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS A AND B), VARIANTS LEU-479 AND SER-759.
Tissue: Lung and Testis.
[4]"Direct binding of Lgl2 to LGN during mitosis and its requirement for normal cell division."
Yasumi M., Sakisaka T., Hoshino T., Kimura T., Sakamoto Y., Yamanaka T., Ohno S., Takai Y.
J. Biol. Chem. 280:6761-6765(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH GPSM2/LGN, SUBCELLULAR LOCATION, FUNCTION.
Tissue: Brain.
[5]"Mammalian Lgl forms a protein complex with PAR-6 and aPKC independently of PAR-3 to regulate epithelial cell polarity."
Yamanaka T., Horikoshi Y., Sugiyama Y., Ishiyama C., Suzuki A., Hirose T., Iwamatsu A., Shinohara A., Ohno S.
Curr. Biol. 13:734-743(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH PARD6B/PAR-6 AND PRKCI/APKC, PHOSPHORYLATION AT SER-653, MUTAGENESIS OF SER-641; SER-645; SER-649; SER-653; SER-660 AND SER-663.
[6]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1015, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[7]"Involvement of Lgl and Mahjong/VprBP in cell competition."
Tamori Y., Bialucha C.U., Tian A.G., Kajita M., Huang Y.C., Norman M., Harrison N., Poulton J., Ivanovitch K., Disch L., Liu T., Deng W.M., Fujita Y.
PLoS Biol. 8:E1000422-E1000422(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH VPRBP.
[8]"System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
X87342 mRNA. Translation: CAA60780.1.
AC100787 Genomic DNA. No translation available.
BC006503 mRNA. Translation: AAH06503.1.
BC010879 mRNA. Translation: AAH10879.1.
BC064994 mRNA. Translation: AAH64994.1.
CCDSCCDS11725.1. [Q6P1M3-2]
CCDS32733.1. [Q6P1M3-1]
CCDS45776.1. [Q6P1M3-3]
PIRS55474.
RefSeqNP_001015002.1. NM_001015002.1. [Q6P1M3-3]
NP_001026973.1. NM_001031803.1. [Q6P1M3-1]
NP_004515.2. NM_004524.2. [Q6P1M3-2]
UniGeneHs.514477.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
3WP0X-ray2.04B640-654[»]
3WP1X-ray2.80A646-657[»]
ProteinModelPortalQ6P1M3.
SMRQ6P1M3. Positions 217-247, 589-621.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid110181. 6 interactions.
IntActQ6P1M3. 5 interactions.
MINTMINT-261325.
STRING9606.ENSP00000376333.

PTM databases

PhosphoSiteQ6P1M3.

Polymorphism databases

DMDM93204600.

Proteomic databases

MaxQBQ6P1M3.
PaxDbQ6P1M3.
PRIDEQ6P1M3.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000167462; ENSP00000167462; ENSG00000073350. [Q6P1M3-2]
ENST00000375227; ENSP00000364375; ENSG00000073350. [Q6P1M3-3]
ENST00000392550; ENSP00000376333; ENSG00000073350. [Q6P1M3-1]
ENST00000578363; ENSP00000464603; ENSG00000073350. [Q6P1M3-3]
GeneID3993.
KEGGhsa:3993.
UCSCuc002jog.1. human. [Q6P1M3-3]
uc002joh.3. human. [Q6P1M3-1]
uc002joi.3. human. [Q6P1M3-2]

Organism-specific databases

CTD3993.
GeneCardsGC17P073521.
HGNCHGNC:6629. LLGL2.
HPAHPA022913.
neXtProtNX_Q6P1M3.
PharmGKBPA30397.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG289584.
HOGENOMHOG000115700.
HOVERGENHBG052711.
InParanoidQ6P1M3.
KOK06094.
OMAQCQPPAV.
OrthoDBEOG79W94C.
PhylomeDBQ6P1M3.
TreeFamTF314585.

Enzyme and pathway databases

SignaLinkQ6P1M3.

Gene expression databases

ArrayExpressQ6P1M3.
BgeeQ6P1M3.
CleanExHS_LLGL2.
GenevestigatorQ6P1M3.

Family and domain databases

Gene3D2.130.10.10. 3 hits.
InterProIPR000664. Lethal2_giant.
IPR013577. LLGL2.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamPF08366. LLGL. 1 hit.
PF00400. WD40. 1 hit.
[Graphical view]
PRINTSPR00962. LETHAL2GIANT.
SMARTSM00320. WD40. 5 hits.
[Graphical view]
SUPFAMSSF50978. SSF50978. 5 hits.
PROSITEPS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSLLGL2. human.
GenomeRNAi3993.
NextBio15664.
PROQ6P1M3.

Entry information

Entry nameL2GL2_HUMAN
AccessionPrimary (citable) accession number: Q6P1M3
Secondary accession number(s): Q14521, Q9BR62
Entry history
Integrated into UniProtKB/Swiss-Prot: April 18, 2006
Last sequence update: April 18, 2006
Last modified: July 9, 2014
This is version 100 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 17

Human chromosome 17: entries, gene names and cross-references to MIM