Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Polyamine-modulated factor 1

Gene

PMF1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Part of the MIS12 complex which is required for normal chromosome alignment and segregation and kinetochore formation during mitosis. May act as a cotranscription partner of NFE2L2 involved in regulation of polyamine-induced transcription of SSAT.4 Publications

GO - Molecular functioni

  • leucine zipper domain binding Source: UniProtKB
  • transcription coactivator activity Source: UniProtKB

GO - Biological processi

  • cell division Source: UniProtKB-KW
  • chromosome segregation Source: UniProtKB
  • mitotic cell cycle Source: Reactome
  • mitotic nuclear division Source: UniProtKB-KW
  • regulation of transcription, DNA-templated Source: UniProtKB-KW
  • small GTPase mediated signal transduction Source: Reactome
  • transcription from RNA polymerase II promoter Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Cell cycle, Cell division, Chromosome partition, Mitosis, Transcription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-HSA-2467813. Separation of Sister Chromatids.
R-HSA-2500257. Resolution of Sister Chromatid Cohesion.
R-HSA-5663220. RHO GTPases Activate Formins.
R-HSA-68877. Mitotic Prometaphase.

Names & Taxonomyi

Protein namesi
Recommended name:
Polyamine-modulated factor 1
Short name:
PMF-1
Gene namesi
Name:PMF1Imported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:9112. PMF1.

Subcellular locationi

GO - Cellular componenti

  • cytosol Source: Reactome
  • MIS12/MIND type complex Source: UniProtKB
  • nucleoplasm Source: HPA
  • transcription factor complex Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Centromere, Chromosome, Kinetochore, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA33438.

Polymorphism and mutation databases

BioMutaiPMF1.
DMDMi114152119.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 205205Polyamine-modulated factor 1PRO_0000248237Add
BLAST

Proteomic databases

EPDiQ6P1K2.
MaxQBiQ6P1K2.
PaxDbiQ6P1K2.
PRIDEiQ6P1K2.

PTM databases

iPTMnetiQ6P1K2.
PhosphoSiteiQ6P1K2.

Expressioni

Tissue specificityi

Highest levels of expression in heart and skeletal muscle, with significant levels expressed in kidney and liver.1 Publication

Inductioni

By polyamine analogs in analog-sensitive H157 cells.1 Publication

Gene expression databases

BgeeiQ6P1K2.
ExpressionAtlasiQ6P1K2. baseline and differential.
GenevisibleiQ6P1K2. HS.

Organism-specific databases

HPAiCAB009912.

Interactioni

Subunit structurei

Component of the MIS12 complex composed of MIS12, DSN1, NSL1 and PMF1. Interacts with COPS7A. Interacts via its coiled-coil domain with the leucine-zipper domain of NFE2L2. The interaction with NFE2L2 is required for the transcriptional regulation of SSAT.3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
MIS12Q9H0818EBI-713832,EBI-1001205
USHBP1Q8N6Y03EBI-713832,EBI-739895

GO - Molecular functioni

  • leucine zipper domain binding Source: UniProtKB

Protein-protein interaction databases

BioGridi116405. 57 interactions.
IntActiQ6P1K2. 27 interactions.
MINTiMINT-1386485.
STRINGi9606.ENSP00000458021.

Structurei

3D structure databases

ProteinModelPortaliQ6P1K2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili141 – 19353Sequence analysisAdd
BLAST

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IWZA. Eukaryota.
ENOG4111Q9B. LUCA.
GeneTreeiENSGT00390000006469.
HOGENOMiHOG000012991.
HOVERGENiHBG058607.
InParanoidiQ6P1K2.
KOiK11546.
OMAiKEPACSG.
OrthoDBiEOG76DTV7.
PhylomeDBiQ6P1K2.
TreeFamiTF333180.

Family and domain databases

InterProiIPR007128. PMF1/NNF1.
[Graphical view]
PfamiPF03980. Nnf1. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q6P1K2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEASSANLG SGCEEKRHEG SSSESVPPGT TISRVKLLDT MVDTFLQKLV
60 70 80 90 100
AAGSYQRFTD CYKCFYQLQP AMTQQIYDKF IAQLQTSIRE EISDIKEEGN
110 120 130 140 150
LEAVLNALDK IVEEGKVRKE PAWRPSGIPE KDLHSVMAPY FLQQRDTLRR
160 170 180 190 200
HVQKQEAENQ QLADAVLAGR RQVEELQLQV QAQQQAWQAL HREQRELVAV

LREPE
Length:205
Mass (Da):23,339
Last modified:September 5, 2006 - v2
Checksum:iDAE3A0BF43F14820
GO
Isoform 21 Publication (identifier: Q6P1K2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     55-89: YQRFTDCYKCFYQLQPAMTQQIYDKFIAQLQTSIR → SPLLHWDGSAGPRLPSGGQSVKQAFSWAACRLPQGRK

Note: Gene prediction based on EST data.Curated
Show »
Length:207
Mass (Da):22,946
Checksum:iB50E380BE85B678B
GO
Isoform 31 Publication (identifier: Q6P1K2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     124-175: RPSGIPEKDL...VLAGRRQVEE → CEAQRCRVQQ...GSPGAQEGGV
     176-205: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:175
Mass (Da):18,977
Checksum:iB08DD8F2EA3F9304
GO
Isoform 41 Publication (identifier: Q6P1K2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: Missing.

Show »
Length:165
Mass (Da):19,238
Checksum:iDEF5C0B35A882F5D
GO
Isoform 51 Publication (identifier: Q6P1K2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     123-205: WRPSGIPEKD...ELVAVLREPE → CNGTPCGAMC...GSPGAQEGGV

Note: Gene prediction based on EST data.Curated
Show »
Length:220
Mass (Da):24,032
Checksum:iC9323A96E0CEE881
GO
Isoform 6 (identifier: Q6P1K2-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     123-205: WRPSGIPEKD...ELVAVLREPE → CNGTPCGAMC...TENRGSWLLC

Note: No experimental confirmation available.
Show »
Length:180
Mass (Da):20,230
Checksum:iC40BFF6867253665
GO

Sequence cautioni

The sequence AAD50081.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAH10730.1 differs from that shown. Reason: Frameshift at position 75. Curated
The sequence CAH10730.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti2 – 21A → G in CAH10730 (PubMed:17974005).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti75 – 751Q → R.3 Publications
Corresponds to variant rs1052053 [ dbSNP | Ensembl ].
VAR_034147
Natural varianti137 – 1371M → I.2 Publications
Corresponds to variant rs1052067 [ dbSNP | Ensembl ].
VAR_034148

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4040Missing in isoform 4. 1 PublicationVSP_052136Add
BLAST
Alternative sequencei55 – 8935YQRFT…QTSIR → SPLLHWDGSAGPRLPSGGQS VKQAFSWAACRLPQGRK in isoform 2. 1 PublicationVSP_052137Add
BLAST
Alternative sequencei123 – 20583WRPSG…LREPE → CNGTPCGAMCRNRRPRTSSW QMPSWQGGGRWRSCSYRSRP SSRPGRCEAQRCRVQQRCSL CVQAGGQRGSEETQALPVSM AGSPSPLPGSPGAQEGGV in isoform 5. 1 PublicationVSP_052138Add
BLAST
Alternative sequencei123 – 20583WRPSG…LREPE → CNGTPCGAMCRNRRPRTSSW QMPSWQGGGRWRSCSYRSRP SSRPGRLYTENRGSWLLC in isoform 6. 1 PublicationVSP_044638Add
BLAST
Alternative sequencei124 – 17552RPSGI…RQVEE → CEAQRCRVQQRCSLCVQAGG QRGSEETQALPVSMAGSPSP LPGSPGAQEGGV in isoform 3. 1 PublicationVSP_052139Add
BLAST
Alternative sequencei176 – 20530Missing in isoform 3. 1 PublicationVSP_052140Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF141309, AF141308 Genomic DNA. Translation: AAD50080.1.
AF141310 mRNA. Translation: AAD50081.1. Different initiation.
AK124646 mRNA. Translation: BAC85916.1.
AK289490 mRNA. Translation: BAF82179.1.
AK290260 mRNA. Translation: BAF82949.1.
AL135927 Genomic DNA. No translation available.
CH471121 Genomic DNA. Translation: EAW52989.1.
CH471121 Genomic DNA. Translation: EAW52990.1.
BC033656 mRNA. No translation available.
BC050735 mRNA. Translation: AAH50735.1.
BC056417 mRNA. Translation: AAH56417.1.
BC065031 mRNA. Translation: AAH65031.1.
AL080101 mRNA. Translation: CAH10730.1. Sequence problems.
CCDSiCCDS30886.1. [Q6P1K2-1]
CCDS55648.1. [Q6P1K2-2]
CCDS55649.1. [Q6P1K2-6]
RefSeqiNP_001186582.1. NM_001199653.1. [Q6P1K2-6]
NP_001186583.1. NM_001199654.1. [Q6P1K2-2]
NP_001186590.1. NM_001199661.1. [Q6P1K2-5]
NP_001186592.1. NM_001199663.1. [Q6P1K2-3]
NP_009152.2. NM_007221.3. [Q6P1K2-1]
UniGeneiHs.530479.
Hs.654541.

Genome annotation databases

EnsembliENST00000368273; ENSP00000357256; ENSG00000160783. [Q6P1K2-2]
ENST00000368277; ENSP00000357260; ENSG00000160783. [Q6P1K2-1]
ENST00000368279; ENSP00000357262; ENSG00000160783. [Q6P1K2-6]
GeneIDi100527963.
11243.
KEGGihsa:100527963.
hsa:11243.
UCSCiuc001fnq.4. human. [Q6P1K2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF141309, AF141308 Genomic DNA. Translation: AAD50080.1.
AF141310 mRNA. Translation: AAD50081.1. Different initiation.
AK124646 mRNA. Translation: BAC85916.1.
AK289490 mRNA. Translation: BAF82179.1.
AK290260 mRNA. Translation: BAF82949.1.
AL135927 Genomic DNA. No translation available.
CH471121 Genomic DNA. Translation: EAW52989.1.
CH471121 Genomic DNA. Translation: EAW52990.1.
BC033656 mRNA. No translation available.
BC050735 mRNA. Translation: AAH50735.1.
BC056417 mRNA. Translation: AAH56417.1.
BC065031 mRNA. Translation: AAH65031.1.
AL080101 mRNA. Translation: CAH10730.1. Sequence problems.
CCDSiCCDS30886.1. [Q6P1K2-1]
CCDS55648.1. [Q6P1K2-2]
CCDS55649.1. [Q6P1K2-6]
RefSeqiNP_001186582.1. NM_001199653.1. [Q6P1K2-6]
NP_001186583.1. NM_001199654.1. [Q6P1K2-2]
NP_001186590.1. NM_001199661.1. [Q6P1K2-5]
NP_001186592.1. NM_001199663.1. [Q6P1K2-3]
NP_009152.2. NM_007221.3. [Q6P1K2-1]
UniGeneiHs.530479.
Hs.654541.

3D structure databases

ProteinModelPortaliQ6P1K2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116405. 57 interactions.
IntActiQ6P1K2. 27 interactions.
MINTiMINT-1386485.
STRINGi9606.ENSP00000458021.

PTM databases

iPTMnetiQ6P1K2.
PhosphoSiteiQ6P1K2.

Polymorphism and mutation databases

BioMutaiPMF1.
DMDMi114152119.

Proteomic databases

EPDiQ6P1K2.
MaxQBiQ6P1K2.
PaxDbiQ6P1K2.
PRIDEiQ6P1K2.

Protocols and materials databases

DNASUi11243.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000368273; ENSP00000357256; ENSG00000160783. [Q6P1K2-2]
ENST00000368277; ENSP00000357260; ENSG00000160783. [Q6P1K2-1]
ENST00000368279; ENSP00000357262; ENSG00000160783. [Q6P1K2-6]
GeneIDi100527963.
11243.
KEGGihsa:100527963.
hsa:11243.
UCSCiuc001fnq.4. human. [Q6P1K2-1]

Organism-specific databases

CTDi100527963.
11243.
GeneCardsiPMF1.
HGNCiHGNC:9112. PMF1.
HPAiCAB009912.
MIMi609176. gene.
neXtProtiNX_Q6P1K2.
PharmGKBiPA33438.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IWZA. Eukaryota.
ENOG4111Q9B. LUCA.
GeneTreeiENSGT00390000006469.
HOGENOMiHOG000012991.
HOVERGENiHBG058607.
InParanoidiQ6P1K2.
KOiK11546.
OMAiKEPACSG.
OrthoDBiEOG76DTV7.
PhylomeDBiQ6P1K2.
TreeFamiTF333180.

Enzyme and pathway databases

ReactomeiR-HSA-2467813. Separation of Sister Chromatids.
R-HSA-2500257. Resolution of Sister Chromatid Cohesion.
R-HSA-5663220. RHO GTPases Activate Formins.
R-HSA-68877. Mitotic Prometaphase.

Miscellaneous databases

ChiTaRSiPMF1. human.
GeneWikiiPolyamine-modulated_factor_1.
NextBioi42782.
PROiQ6P1K2.
SOURCEiSearch...

Gene expression databases

BgeeiQ6P1K2.
ExpressionAtlasiQ6P1K2. baseline and differential.
GenevisibleiQ6P1K2. HS.

Family and domain databases

InterProiIPR007128. PMF1/NNF1.
[Graphical view]
PfamiPF03980. Nnf1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of human polyamine-modulated factor-1, a transcriptional cofactor that regulates the transcription of the spermidine/spermine N(1)-acetyltransferase gene."
    Wang Y., Devereux W., Stewart T.M., Casero R.A. Jr.
    J. Biol. Chem. 274:22095-22101(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 4), NUCLEOTIDE SEQUENCE [MRNA] OF 4-205 (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, INDUCTION, VARIANTS ARG-75 AND ILE-137.
    Tissue: Lung carcinomaImported.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 6), VARIANT ARG-75.
    Tissue: Cerebellum and Colon.
  3. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANTS ARG-75 AND ILE-137.
    Tissue: ColonImported, SkinImported, TestisImported and Uterus.
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 2-205 (ISOFORM 1).
    Tissue: Brain.
  7. "Characterization of the interaction between the transcription factors human polyamine modulated factor (PMF-1) and NF-E2-related factor 2 (Nrf-2) in the transcriptional regulation of the spermidine/spermine N1-acetyltransferase (SSAT) gene."
    Wang Y., Devereux W., Stewart T.M., Casero R.A. Jr.
    Biochem. J. 355:45-49(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH NFE2L2.
  8. "Polyamine-modulated factor 1 binds to the human homologue of the 7a subunit of the Arabidopsis COP9 signalosome: implications in gene expression."
    Wang Y., Devereux W., Stewart T.M., Casero R.A. Jr.
    Biochem. J. 366:79-86(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH COPS7A.
  9. "A conserved Mis12 centromere complex is linked to heterochromatic HP1 and outer kinetochore protein Zwint-1."
    Obuse C., Iwasaki O., Kiyomitsu T., Goshima G., Toyoda Y., Yanagida M.
    Nat. Cell Biol. 6:1135-1141(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH DSN1 AND MIS12, IDENTIFICATION BY MASS SPECTROMETRY.
  10. "The human Mis12 complex is required for kinetochore assembly and proper chromosome segregation."
    Kline S.L., Cheeseman I.M., Hori T., Fukagawa T., Desai A.
    J. Cell Biol. 173:9-17(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, COMPONENT OF MIS12 COMPLEX, SUBCELLULAR LOCATION.

Entry informationi

Entry nameiPMF1_HUMAN
AccessioniPrimary (citable) accession number: Q6P1K2
Secondary accession number(s): A8K0C5
, Q5TCJ8, Q5TCJ9, Q5TCK0, Q5TCK1, Q5TCK3, Q69YZ9, Q6PHR4, Q6ZVE6, Q86VJ6, Q8N4T6, Q9UBQ3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 5, 2006
Last sequence update: September 5, 2006
Last modified: April 13, 2016
This is version 109 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.