Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Polyamine-modulated factor 1

Gene

PMF1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Part of the MIS12 complex which is required for normal chromosome alignment and segregation and kinetochore formation during mitosis. May act as a cotranscription partner of NFE2L2 involved in regulation of polyamine-induced transcription of SSAT.4 Publications

GO - Molecular functioni

  • leucine zipper domain binding Source: UniProtKB
  • transcription coactivator activity Source: UniProtKB

GO - Biological processi

  • cell division Source: UniProtKB-KW
  • chromosome segregation Source: UniProtKB
  • regulation of transcription, DNA-templated Source: UniProtKB-KW
  • sister chromatid cohesion Source: Reactome
  • transcription from RNA polymerase II promoter Source: ProtInc

Keywordsi

Molecular functionActivator
Biological processCell cycle, Cell division, Chromosome partition, Mitosis, Transcription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-HSA-141444. Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal.
R-HSA-2467813. Separation of Sister Chromatids.
R-HSA-2500257. Resolution of Sister Chromatid Cohesion.
R-HSA-5663220. RHO GTPases Activate Formins.
R-HSA-68877. Mitotic Prometaphase.

Names & Taxonomyi

Protein namesi
Recommended name:
Polyamine-modulated factor 1
Short name:
PMF-1
Gene namesi
Name:PMF1Imported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000160783.19.
HGNCiHGNC:9112. PMF1.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Centromere, Chromosome, Kinetochore, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi100527963.
11243.
OpenTargetsiENSG00000160783.
ENSG00000260238.
PharmGKBiPA33438.

Polymorphism and mutation databases

BioMutaiPMF1.
DMDMi114152119.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002482371 – 205Polyamine-modulated factor 1Add BLAST205

Proteomic databases

EPDiQ6P1K2.
MaxQBiQ6P1K2.
PaxDbiQ6P1K2.
PeptideAtlasiQ6P1K2.
PRIDEiQ6P1K2.

PTM databases

iPTMnetiQ6P1K2.
PhosphoSitePlusiQ6P1K2.

Expressioni

Tissue specificityi

Highest levels of expression in heart and skeletal muscle, with significant levels expressed in kidney and liver.1 Publication

Inductioni

By polyamine analogs in analog-sensitive H157 cells.1 Publication

Gene expression databases

BgeeiENSG00000160783.
ExpressionAtlasiQ6P1K2. baseline and differential.
GenevisibleiQ6P1K2. HS.

Organism-specific databases

HPAiHPA034583.
HPA071854.

Interactioni

Subunit structurei

Component of the MIS12 complex composed of MIS12, DSN1, NSL1 and PMF1. Interacts with COPS7A. Interacts via its coiled-coil domain with the leucine-zipper domain of NFE2L2. The interaction with NFE2L2 is required for the transcriptional regulation of SSAT.3 Publications

Binary interactionsi

Show more details

GO - Molecular functioni

  • leucine zipper domain binding Source: UniProtKB

Protein-protein interaction databases

BioGridi116405. 61 interactors.
CORUMiQ6P1K2.
IntActiQ6P1K2. 34 interactors.
MINTiMINT-1386485.
STRINGi9606.ENSP00000458021.

Structurei

Secondary structure

1205
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Turni32 – 34Combined sources3
Helixi35 – 51Combined sources17
Helixi56 – 61Combined sources6
Helixi63 – 66Combined sources4
Helixi70 – 96Combined sources27
Turni97 – 100Combined sources4
Helixi101 – 115Combined sources15
Helixi129 – 188Combined sources60
Helixi190 – 200Combined sources11

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5LSJX-ray3.25B/E31-205[»]
5LSKX-ray3.50B31-205[»]
ProteinModelPortaliQ6P1K2.
SMRiQ6P1K2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili141 – 193Sequence analysisAdd BLAST53

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IWZA. Eukaryota.
ENOG4111Q9B. LUCA.
GeneTreeiENSGT00390000006469.
HOGENOMiHOG000012991.
HOVERGENiHBG058607.
InParanoidiQ6P1K2.
KOiK11546.
OMAiYQLQPEV.
OrthoDBiEOG091G0WAU.
PhylomeDBiQ6P1K2.
TreeFamiTF333180.

Family and domain databases

Gene3Di1.20.1270.60. 1 hit.
InterProiView protein in InterPro
IPR027267. AH/BAR-dom.
IPR007128. PMF1/NNF1.
PfamiView protein in Pfam
PF03980. Nnf1. 1 hit.

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q6P1K2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEASSANLG SGCEEKRHEG SSSESVPPGT TISRVKLLDT MVDTFLQKLV
60 70 80 90 100
AAGSYQRFTD CYKCFYQLQP AMTQQIYDKF IAQLQTSIRE EISDIKEEGN
110 120 130 140 150
LEAVLNALDK IVEEGKVRKE PAWRPSGIPE KDLHSVMAPY FLQQRDTLRR
160 170 180 190 200
HVQKQEAENQ QLADAVLAGR RQVEELQLQV QAQQQAWQAL HREQRELVAV

LREPE
Length:205
Mass (Da):23,339
Last modified:September 5, 2006 - v2
Checksum:iDAE3A0BF43F14820
GO
Isoform 21 Publication (identifier: Q6P1K2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     55-89: YQRFTDCYKCFYQLQPAMTQQIYDKFIAQLQTSIR → SPLLHWDGSAGPRLPSGGQSVKQAFSWAACRLPQGRK

Note: Gene prediction based on EST data.Curated
Show »
Length:207
Mass (Da):22,946
Checksum:iB50E380BE85B678B
GO
Isoform 31 Publication (identifier: Q6P1K2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     124-175: RPSGIPEKDL...VLAGRRQVEE → CEAQRCRVQQ...GSPGAQEGGV
     176-205: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:175
Mass (Da):18,977
Checksum:iB08DD8F2EA3F9304
GO
Isoform 41 Publication (identifier: Q6P1K2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: Missing.

Show »
Length:165
Mass (Da):19,238
Checksum:iDEF5C0B35A882F5D
GO
Isoform 51 Publication (identifier: Q6P1K2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     123-205: WRPSGIPEKD...ELVAVLREPE → CNGTPCGAMC...GSPGAQEGGV

Note: Gene prediction based on EST data.Curated
Show »
Length:220
Mass (Da):24,032
Checksum:iC9323A96E0CEE881
GO
Isoform 6 (identifier: Q6P1K2-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     123-205: WRPSGIPEKD...ELVAVLREPE → CNGTPCGAMC...TENRGSWLLC

Note: No experimental confirmation available.
Show »
Length:180
Mass (Da):20,230
Checksum:iC40BFF6867253665
GO

Sequence cautioni

Q6P1K2: The sequence AAD50081 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
Q6P1K2: The sequence CAH10730 differs from that shown. Reason: Frameshift at position 75.Curated
Q6P1K2: The sequence CAH10730 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti2A → G in CAH10730 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03414775Q → R3 PublicationsCorresponds to variant dbSNP:rs1052053Ensembl.1
Natural variantiVAR_034148137M → I2 PublicationsCorresponds to variant dbSNP:rs1052067Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0521361 – 40Missing in isoform 4. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_05213755 – 89YQRFT…QTSIR → SPLLHWDGSAGPRLPSGGQS VKQAFSWAACRLPQGRK in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_052138123 – 205WRPSG…LREPE → CNGTPCGAMCRNRRPRTSSW QMPSWQGGGRWRSCSYRSRP SSRPGRCEAQRCRVQQRCSL CVQAGGQRGSEETQALPVSM AGSPSPLPGSPGAQEGGV in isoform 5. 1 PublicationAdd BLAST83
Alternative sequenceiVSP_044638123 – 205WRPSG…LREPE → CNGTPCGAMCRNRRPRTSSW QMPSWQGGGRWRSCSYRSRP SSRPGRLYTENRGSWLLC in isoform 6. 1 PublicationAdd BLAST83
Alternative sequenceiVSP_052139124 – 175RPSGI…RQVEE → CEAQRCRVQQRCSLCVQAGG QRGSEETQALPVSMAGSPSP LPGSPGAQEGGV in isoform 3. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_052140176 – 205Missing in isoform 3. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF141309, AF141308 Genomic DNA. Translation: AAD50080.1.
AF141310 mRNA. Translation: AAD50081.1. Different initiation.
AK124646 mRNA. Translation: BAC85916.1.
AK289490 mRNA. Translation: BAF82179.1.
AK290260 mRNA. Translation: BAF82949.1.
AL135927 Genomic DNA. No translation available.
CH471121 Genomic DNA. Translation: EAW52989.1.
CH471121 Genomic DNA. Translation: EAW52990.1.
BC033656 mRNA. No translation available.
BC050735 mRNA. Translation: AAH50735.1.
BC056417 mRNA. Translation: AAH56417.1.
BC065031 mRNA. Translation: AAH65031.1.
AL080101 mRNA. Translation: CAH10730.1. Sequence problems.
CCDSiCCDS30886.1. [Q6P1K2-1]
CCDS55648.1. [Q6P1K2-2]
CCDS55649.1. [Q6P1K2-6]
RefSeqiNP_001186582.1. NM_001199653.1. [Q6P1K2-6]
NP_001186583.1. NM_001199654.1. [Q6P1K2-2]
NP_001186590.1. NM_001199661.1. [Q6P1K2-5]
NP_001186592.1. NM_001199663.1. [Q6P1K2-3]
NP_009152.2. NM_007221.3. [Q6P1K2-1]
UniGeneiHs.530479.
Hs.654541.

Genome annotation databases

EnsembliENST00000368273; ENSP00000357256; ENSG00000160783. [Q6P1K2-2]
ENST00000368277; ENSP00000357260; ENSG00000160783. [Q6P1K2-1]
ENST00000368279; ENSP00000357262; ENSG00000160783. [Q6P1K2-6]
GeneIDi100527963.
11243.
KEGGihsa:100527963.
hsa:11243.
UCSCiuc001fnq.4. human. [Q6P1K2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiPMF1_HUMAN
AccessioniPrimary (citable) accession number: Q6P1K2
Secondary accession number(s): A8K0C5
, Q5TCJ8, Q5TCJ9, Q5TCK0, Q5TCK1, Q5TCK3, Q69YZ9, Q6PHR4, Q6ZVE6, Q86VJ6, Q8N4T6, Q9UBQ3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 5, 2006
Last sequence update: September 5, 2006
Last modified: October 25, 2017
This is version 124 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references