Reviewed,
UniProtKB/Swiss-Prot Q6P1G2 (JHD1B_MOUSE)
Last modified
December 16, 2008.
Version 56.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: JmjC domain-containing histone demethylation protein 1B EC=1.14.11.27 Alternative name(s): [Histone-H3]-lysine-36 demethylase 1B F-box and leucine-rich repeat protein 10 F-box/LRR-repeat protein 10 F-box protein FBL10 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 1309 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Histone demethylase that specifically demethylates 'Lys-36' of histone H3, thereby playing a central role in histone code. Preferentially demethylates dimethylated H3 'Lys-36' residue while it has weak or no activity for mono- and tri-methylted H3 'Lys-36'. May also serve as a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex By similarity. |
| Catalytic activity | Protein N(6),N(6)-dimethyl-L-lysine + 2-oxoglutarate + O(2) = protein N(6)-methyl-L-lysine + succinate + formaldehyde + CO(2). Protein N(6)-methyl-L-lysine + 2-oxoglutarate + O(2) = protein L-lysine + succinate + formaldehyde + CO(2). |
| Cofactor | Binds 1 Fe(2+) ion per subunit By similarity. |
| Subunit structure | Directly interacts with SKP1A and CUL1 By similarity. |
| Subcellular location | NucleusBy similarity. |
| Sequence similarities | Belongs to the JHDM1 histone demethylase family. Contains 1 CXXC-type zinc finger. Contains 1 F-box domain. Contains 1 JmjC domain. Contains 4 LRR (leucine-rich) repeats. Contains 1 PHD-type zinc finger. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6P1G2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6P1G2-2) The sequence of this isoform differs from the canonical sequence as follows: 1-533: Missing. 534-551: TLAITGVPVVSWPKKTAK → MAMSVSAEDDDYESEPDQ | ||||||
| Isoform 3 (identifier: Q6P1G2-3) The sequence of this isoform differs from the canonical sequence as follows: 627-656: PVLPHTAVCLVCGEAGKEDTVEEEEGKFNL → VSAQKAQAGLMQGLPAICPALGLLCGMGEV 657-1309: Missing. | ||||||
| Notes: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q6P1G2-4) The sequence of this isoform differs from the canonical sequence as follows: 2-1196: Missing. | ||||||
| Notes: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1309 | 1309 | JmjC domain-containing histone demethylation protein 1B | PRO_0000119854 | |||||
Regions | |||||||||
| Domain | 147 – 315 | 169 | JmjC | ||||||
| Domain | 1032 – 1078 | 47 | F-box | ||||||
| Repeat | 1121 – 1144 | 24 | LRR 1 | ||||||
| Repeat | 1185 – 1208 | 24 | LRR 2 | ||||||
| Repeat | 1242 – 1266 | 25 | LRR 3 | ||||||
| Repeat | 1267 – 1309 | 43 | LRR 4 | ||||||
| Zinc finger | 579 – 625 | 47 | CXXC-type | ||||||
| Zinc finger | 632 – 698 | 67 | PHD-type | ||||||
| Coiled coil | 916 – 944 | 29 | Potential | ||||||
| Compositional bias | 378 – 403 | 26 | Glu-rich | ||||||
Sites | |||||||||
| Metal binding | 211 | 1 | Iron; catalytic By similarity | ||||||
| Metal binding | 213 | 1 | Iron; catalytic By similarity | ||||||
| Metal binding | 283 | 1 | Iron; catalytic By similarity | ||||||
| Binding site | 208 | 1 | Substrate By similarity | ||||||
| Binding site | 228 | 1 | Substrate By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 192 | 1 | Phosphotyrosine By similarity | ||||||
| Modified residue | 447 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 470 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 533 | 533 | Missing in isoform 2. | VSP_011342 | |||||
| Alternative sequence | 2 – 1196 | 1195 | Missing in isoform 4. | VSP_019003 | |||||
| Alternative sequence | 534 – 551 | 18 | TLAIT…KKTAK → MAMSVSAEDDDYESEPDQ in isoform 2. | VSP_011343 | |||||
| Alternative sequence | 627 – 656 | 30 | PVLPH…GKFNL → VSAQKAQAGLMQGLPAICPA LGLLCGMGEV in isoform 3. | VSP_017477 | |||||
| Alternative sequence | 657 – 1309 | 653 | Missing in isoform 3. | VSP_017478 | |||||
Experimental info | |||||||||
| Sequence conflict | 461 | 1 | T → M in BAC98289. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4). Strain: C57BL/6J. Tissue: Cerebellum and Embryo. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Strain: C57BL/6. Tissue: Brain. |
| [3] | "Prediction of the coding sequences of mouse homologues of KIAA gene: III. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries." Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Nagase T., Ohara O., Koga H. DNA Res. 10:167-180(2003) [PubMed: 14621295] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 6-1309 (ISOFORM 1). Tissue: Brain. |
| [4] | "A family of mammalian F-box proteins." Winston J.T., Koepp D.M., Zhu C., Elledge S.J., Harper J.W. Curr. Biol. 9:1180-1182(1999) [PubMed: 10531037] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1011-1309 (ISOFORMS 1/2). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AK012952 mRNA. Translation: BAB28568.2. AK043352 mRNA. Translation: BAE20639.1. BC057622 mRNA. Translation: AAH57622.1. BC065090 mRNA. Translation: AAH65090.1. AK129479 mRNA. Translation: BAC98289.1. AF176524 mRNA. Translation: AAF09133.1. | |
| RefSeq | NP_001003953.1. NP_001005866.1. NP_038938.1. |
| UniGene | Mm.86406 |
3D structure databases | |
| SMR | Q6P1G2. Positions 35-361. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q6P1G2. 12 interactions. |
PTM databases | |
| PhosphoSite | Q6P1G2. |
Proteomic databases | |
| PRIDE | Q6P1G2. |
Genome annotation databases | |
| Ensembl | ENSMUSG00000029475. Mus musculus. [Contig view] |
| GeneID | 30841. |
| KEGG | mmu:30841. |
Organism-specific databases | |
| MGI | MGI:1354737. Fbxl10. |
| Rouge | Search... |
Phylogenomic databases | |
| HOGENOM | Q6P1G2. |
| HOVERGEN | Q6P1G2. |
Gene expression databases | |
| CleanEx | MM_FBXL10. |
| GermOnline | ENSMUSG00000029475. Mus musculus. |
Family and domain databases | |
| InterPro | IPR001810. F-box. IPR001611. LRR. IPR013129. TF_JmjC. IPR003347. TF_JmjC_AAH. IPR002857. Znf_CXXC. IPR001965. Znf_PHD. [Graphical view] |
| Pfam | PF00646. F-box. 1 hit. PF02373. JmjC. 1 hit. PF00560. LRR_1. 1 hit. PF02008. zf-CXXC. 1 hit. [Graphical view] |
| SMART | SM00256. FBOX. 1 hit. SM00558. JmjC. 1 hit. SM00249. PHD. 1 hit. [Graphical view] |
| PROSITE | PS50181. FBOX. False negative. PS51184. JMJC. 1 hit. PS51058. ZF_CXXC. 1 hit. PS01359. ZF_PHD_1. False negative. PS50016. ZF_PHD_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 307252. |
| SOURCE | Search... |
Entry information
| Entry name | JHD1B_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q6P1G2 Secondary accession number(s): Q3V396 Q9QZN6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with