Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

E3 ubiquitin-protein ligase MARCH1

Gene

March1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

E3 ubiquitin-protein ligase that mediates ubiquitination of TFRC, CD86, FAS and MHC class II proteins, such as HLA-DR alpha and beta, and promotes their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. By constitutively ubiquitinating MHC class II proteins in immature dendritic cells, down-regulates their cell surface localization thus sequestering them in the intracellular endosomal system.4 Publications

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri72 – 133RING-CH-typePROSITE-ProRule annotationAdd BLAST62

GO - Molecular functioni

  • ligase activity Source: UniProtKB-KW
  • MHC protein binding Source: UniProtKB
  • ubiquitin protein ligase activity Source: MGI
  • ubiquitin-protein transferase activity Source: UniProtKB
  • zinc ion binding Source: InterPro

GO - Biological processi

  • antigen processing and presentation of peptide antigen via MHC class II Source: UniProtKB
  • immune response Source: UniProtKB
  • protein polyubiquitination Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Ligase

Keywords - Biological processi

Immunity, Ubl conjugation pathway

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
E3 ubiquitin-protein ligase MARCH1 (EC:6.3.2.-)
Alternative name(s):
Membrane-associated RING finger protein 1
Membrane-associated RING-CH protein I
Short name:
MARCH-I
Gene namesi
Name:March1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 8

Organism-specific databases

MGIiMGI:1920175. March1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei155 – 175HelicalSequence analysisAdd BLAST21
Transmembranei197 – 217HelicalSequence analysisAdd BLAST21

GO - Cellular componenti

  • cytoplasmic vesicle membrane Source: UniProtKB-SubCell
  • early endosome membrane Source: UniProtKB
  • endoplasmic reticulum membrane Source: UniProtKB
  • endosome Source: MGI
  • integral component of membrane Source: UniProtKB-KW
  • late endosome membrane Source: UniProtKB
  • lysosomal membrane Source: UniProtKB
  • lysosome Source: MGI
  • plasma membrane Source: UniProtKB
  • trans-Golgi network membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasmic vesicle, Endosome, Golgi apparatus, Lysosome, Membrane

Pathology & Biotechi

Disruption phenotypei

Shows increase in the cell surface expression or half-life of MHC class II. Null cells have accumulated MHC class II and CD86 at the cell surface and a low antigen-presenting ability for exogenous antigens, in conventional dendritic cells (PubMed:19917682). Null cells have high antigen-presenting ability for exogenous antigens in B-cells (PubMed:17255932).2 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi114W → A: Loss of ubiquitin ligase activity and loss of down-regulation of CD86 cell surface expression. 1 Publication1
Mutagenesisi225L → S: Partial loss of down-regulation of CD86 cell surface expression. Almost complete loss of down-regulation of CD86 cell surface expression; when associated with F-232. 1 Publication1
Mutagenesisi232Y → F: Almost complete loss of down-regulation of CD86 cell surface expression; when associated with S-225. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002743661 – 289E3 ubiquitin-protein ligase MARCH1Add BLAST289

Post-translational modificationi

Has a short half-life. Instability/short half-life permits rapid changes that allow efficient induction of antigen presentation once antigen presenting cells, APCs, receive maturation signals. Small changes in protein levels significantly alter the cell surface display of MHC class II proteins.

Proteomic databases

PaxDbiQ6NZQ8.
PRIDEiQ6NZQ8.

PTM databases

iPTMnetiQ6NZQ8.
PhosphoSitePlusiQ6NZQ8.

Expressioni

Gene expression databases

BgeeiENSMUSG00000036469.
CleanExiMM_MARCH1.
ExpressionAtlasiQ6NZQ8. baseline and differential.
GenevisibleiQ6NZQ8. MM.

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000072302.

Structurei

3D structure databases

ProteinModelPortaliQ6NZQ8.
SMRiQ6NZQ8.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 66Responsible for low stabilityAdd BLAST66
Regioni222 – 279Responsible for down-regulation of CD86 and MHC class II cell surface expressionAdd BLAST58

Domaini

The RING-CH-type zinc finger domain is required for E3 ligase activity.PROSITE-ProRule annotation

Sequence similaritiesi

Contains 1 RING-CH-type zinc finger.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri72 – 133RING-CH-typePROSITE-ProRule annotationAdd BLAST62

Keywords - Domaini

Transmembrane, Transmembrane helix, Zinc-finger

Phylogenomic databases

eggNOGiKOG1609. Eukaryota.
COG5183. LUCA.
GeneTreeiENSGT00730000110355.
HOGENOMiHOG000113483.
HOVERGENiHBG081957.
InParanoidiQ6NZQ8.
KOiK10656.
OMAiERRKICC.
PhylomeDBiQ6NZQ8.
TreeFamiTF319557.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
InterProiIPR033275. MARCH-like.
IPR011016. Znf_RING-CH.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PANTHERiPTHR23012. PTHR23012. 1 hit.
PfamiPF12906. RINGv. 1 hit.
[Graphical view]
SMARTiSM00744. RINGv. 1 hit.
[Graphical view]
PROSITEiPS51292. ZF_RING_CH. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6NZQ8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLGWCEAIAR NPHRIPNTTR TPETSGDVAD ASQTSTLNEK SPGRSASRSS
60 70 80 90 100
NISKASSPTT GTAPRSQSRL SVCPSTQDIC RICHCEGDEE SPLITPCRCT
110 120 130 140 150
GTLRFVHQSC LHQWIKSSDT RCCELCKYDF IMETKLKPLR KWEKLQMTTS
160 170 180 190 200
ERRKIFCSVT FHVIAVTCVV WSLYVLIDRT AEEIKQGNDN GVLEWPFWTK
210 220 230 240 250
LVVVAIGFTG GLVFMYVQCK VYVQLWRRLK AYNRVIFVQN CPDTANKLEK
260 270 280
NFPCNVNTEI KDAVVVPVPQ TGSNTLPTAE GAPPEVIPV
Length:289
Mass (Da):32,347
Last modified:February 6, 2007 - v2
Checksum:i0DBE9A308D5ED0CE
GO
Isoform 2 (identifier: Q6NZQ8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-54: MLGWCEAIAR...SASRSSNISK → MNLTMSNMTS...DAKLSNLFLQ

Show »
Length:279
Mass (Da):31,757
Checksum:i1CD5F78924C5ED84
GO
Isoform 3 (identifier: Q6NZQ8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MLGWCEAIARNPHRIPNTTRTPETSGDVADASQTSTL → MPLHQISVIPARETASNGRSSMGRNKEKNKEVE

Show »
Length:285
Mass (Da):32,044
Checksum:i70F6BC77496FB682
GO
Isoform 4 (identifier: Q6NZQ8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-54: MLGWCEAIAR...SASRSSNISK → MNLTMSNMTS...DAKLSNLFLQ
     187-190: Missing.

Show »
Length:275
Mass (Da):31,357
Checksum:iF661FBBC452D71BB
GO
Isoform 5 (identifier: Q6NZQ8-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     187-190: Missing.

Show »
Length:285
Mass (Da):31,947
Checksum:i4FFAC6F658DEBE8C
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti85C → Y in BAE31341 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0227261 – 54MLGWC…SNISK → MNLTMSNMTSSHICCNFLNM WKKSKISTMYYLNQDAKLSN LFLQ in isoform 2 and isoform 4. 1 PublicationAdd BLAST54
Alternative sequenceiVSP_0227271 – 37MLGWC…QTSTL → MPLHQISVIPARETASNGRS SMGRNKEKNKEVE in isoform 3. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_022728187 – 190Missing in isoform 4 and isoform 5. 1 Publication4

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK036489 mRNA. Translation: BAC29449.1.
AK089040 mRNA. Translation: BAC40715.1.
AK137337 mRNA. Translation: BAE23311.1.
AK152592 mRNA. Translation: BAE31341.1.
AK163081 mRNA. Translation: BAE37183.1.
BC066008 mRNA. Translation: AAH66008.1.
CCDSiCCDS22333.1. [Q6NZQ8-3]
CCDS52560.1. [Q6NZQ8-5]
CCDS52561.1. [Q6NZQ8-4]
CCDS80884.1. [Q6NZQ8-1]
RefSeqiNP_001159844.1. NM_001166372.1. [Q6NZQ8-5]
NP_001159847.1. NM_001166375.1. [Q6NZQ8-4]
NP_001280713.1. NM_001293784.1. [Q6NZQ8-1]
NP_780397.2. NM_175188.4. [Q6NZQ8-3]
XP_006509821.1. XM_006509758.1. [Q6NZQ8-3]
XP_017168467.1. XM_017312978.1. [Q6NZQ8-3]
UniGeneiMm.380457.

Genome annotation databases

EnsembliENSMUST00000039540; ENSMUSP00000044070; ENSMUSG00000036469. [Q6NZQ8-4]
ENSMUST00000072482; ENSMUSP00000072302; ENSMUSG00000036469. [Q6NZQ8-3]
ENSMUST00000098708; ENSMUSP00000096305; ENSMUSG00000036469. [Q6NZQ8-5]
ENSMUST00000110253; ENSMUSP00000105882; ENSMUSG00000036469. [Q6NZQ8-2]
ENSMUST00000110255; ENSMUSP00000105884; ENSMUSG00000036469. [Q6NZQ8-5]
ENSMUST00000110258; ENSMUSP00000105887; ENSMUSG00000036469. [Q6NZQ8-1]
ENSMUST00000110259; ENSMUSP00000105888; ENSMUSG00000036469. [Q6NZQ8-3]
ENSMUST00000178982; ENSMUSP00000136545; ENSMUSG00000036469. [Q6NZQ8-1]
GeneIDi72925.
KEGGimmu:72925.
UCSCiuc009lvj.2. mouse. [Q6NZQ8-1]
uc009lvk.2. mouse. [Q6NZQ8-5]
uc009lvl.2. mouse. [Q6NZQ8-3]
uc009lvm.2. mouse. [Q6NZQ8-2]
uc009lvn.2. mouse. [Q6NZQ8-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK036489 mRNA. Translation: BAC29449.1.
AK089040 mRNA. Translation: BAC40715.1.
AK137337 mRNA. Translation: BAE23311.1.
AK152592 mRNA. Translation: BAE31341.1.
AK163081 mRNA. Translation: BAE37183.1.
BC066008 mRNA. Translation: AAH66008.1.
CCDSiCCDS22333.1. [Q6NZQ8-3]
CCDS52560.1. [Q6NZQ8-5]
CCDS52561.1. [Q6NZQ8-4]
CCDS80884.1. [Q6NZQ8-1]
RefSeqiNP_001159844.1. NM_001166372.1. [Q6NZQ8-5]
NP_001159847.1. NM_001166375.1. [Q6NZQ8-4]
NP_001280713.1. NM_001293784.1. [Q6NZQ8-1]
NP_780397.2. NM_175188.4. [Q6NZQ8-3]
XP_006509821.1. XM_006509758.1. [Q6NZQ8-3]
XP_017168467.1. XM_017312978.1. [Q6NZQ8-3]
UniGeneiMm.380457.

3D structure databases

ProteinModelPortaliQ6NZQ8.
SMRiQ6NZQ8.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000072302.

PTM databases

iPTMnetiQ6NZQ8.
PhosphoSitePlusiQ6NZQ8.

Proteomic databases

PaxDbiQ6NZQ8.
PRIDEiQ6NZQ8.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000039540; ENSMUSP00000044070; ENSMUSG00000036469. [Q6NZQ8-4]
ENSMUST00000072482; ENSMUSP00000072302; ENSMUSG00000036469. [Q6NZQ8-3]
ENSMUST00000098708; ENSMUSP00000096305; ENSMUSG00000036469. [Q6NZQ8-5]
ENSMUST00000110253; ENSMUSP00000105882; ENSMUSG00000036469. [Q6NZQ8-2]
ENSMUST00000110255; ENSMUSP00000105884; ENSMUSG00000036469. [Q6NZQ8-5]
ENSMUST00000110258; ENSMUSP00000105887; ENSMUSG00000036469. [Q6NZQ8-1]
ENSMUST00000110259; ENSMUSP00000105888; ENSMUSG00000036469. [Q6NZQ8-3]
ENSMUST00000178982; ENSMUSP00000136545; ENSMUSG00000036469. [Q6NZQ8-1]
GeneIDi72925.
KEGGimmu:72925.
UCSCiuc009lvj.2. mouse. [Q6NZQ8-1]
uc009lvk.2. mouse. [Q6NZQ8-5]
uc009lvl.2. mouse. [Q6NZQ8-3]
uc009lvm.2. mouse. [Q6NZQ8-2]
uc009lvn.2. mouse. [Q6NZQ8-4]

Organism-specific databases

CTDi55016.
MGIiMGI:1920175. March1.

Phylogenomic databases

eggNOGiKOG1609. Eukaryota.
COG5183. LUCA.
GeneTreeiENSGT00730000110355.
HOGENOMiHOG000113483.
HOVERGENiHBG081957.
InParanoidiQ6NZQ8.
KOiK10656.
OMAiERRKICC.
PhylomeDBiQ6NZQ8.
TreeFamiTF319557.

Enzyme and pathway databases

UniPathwayiUPA00143.

Miscellaneous databases

ChiTaRSiMarch1. mouse.
PROiQ6NZQ8.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000036469.
CleanExiMM_MARCH1.
ExpressionAtlasiQ6NZQ8. baseline and differential.
GenevisibleiQ6NZQ8. MM.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
InterProiIPR033275. MARCH-like.
IPR011016. Znf_RING-CH.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PANTHERiPTHR23012. PTHR23012. 1 hit.
PfamiPF12906. RINGv. 1 hit.
[Graphical view]
SMARTiSM00744. RINGv. 1 hit.
[Graphical view]
PROSITEiPS51292. ZF_RING_CH. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMARH1_MOUSE
AccessioniPrimary (citable) accession number: Q6NZQ8
Secondary accession number(s): Q3U7M8
, Q3UVF8, Q8C294, Q8CBA1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: February 6, 2007
Last modified: November 2, 2016
This is version 115 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.