Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein FAM122B

Gene

Fam122b

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Protein FAM122B
Gene namesi
Name:Fam122b
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome X

Organism-specific databases

MGIiMGI:1926005. Fam122b.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00002545462 – 255Protein FAM122BAdd BLAST254

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineBy similarity1
Modified residuei25PhosphoserineBy similarity1
Modified residuei33PhosphoserineBy similarity1
Modified residuei50PhosphoserineBy similarity1
Modified residuei58PhosphoserineCombined sources1
Modified residuei112PhosphothreonineBy similarity1
Modified residuei115PhosphoserineCombined sources1
Modified residuei119PhosphoserineCombined sources1
Modified residuei122Omega-N-methylarginineBy similarity1
Modified residuei145PhosphoserineBy similarity1

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

PaxDbiQ6NZE7.
PRIDEiQ6NZE7.

PTM databases

iPTMnetiQ6NZE7.
PhosphoSitePlusiQ6NZE7.

Expressioni

Gene expression databases

BgeeiENSMUSG00000036022.
ExpressionAtlasiQ6NZE7. baseline and differential.
GenevisibleiQ6NZE7. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000069112.

Structurei

3D structure databases

ProteinModelPortaliQ6NZE7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the FAM122 family.Curated

Phylogenomic databases

eggNOGiENOG410IF6F. Eukaryota.
ENOG410ZUHK. LUCA.
GeneTreeiENSGT00390000015476.
HOGENOMiHOG000294073.
HOVERGENiHBG073694.
InParanoidiQ6NZE7.
OMAiDTSYGGT.
OrthoDBiEOG091G0EDK.
PhylomeDBiQ6NZE7.
TreeFamiTF330808.

Family and domain databases

InterProiIPR026716. FAM122.
[Graphical view]
PANTHERiPTHR22227. PTHR22227. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6NZE7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAQEKMDLDF EADTSEGATL RRSNSAPLIH VLSDLSQVFE PYPLRTGRTS
60 70 80 90 100
TAIMSHHSLE EGLDMMNRET TNEREAQAGM QISQSWDESL SLSDSDFDKP
110 120 130 140 150
EKLYSPKRID FTPVSPAPSP TRGFGKQCLS PSLQMFVSSS GMPPSPVLNP
160 170 180 190 200
RHFSRRSQSP VKCIRPSVLG PLKRKGEMEM ESQPKRPFQG TTSMLSTNPA
210 220 230 240 250
QLSDFSSCSD ILDGSSISSG LSSDSLATGS APAESPVACS NSCSPFILMD

DLSPK
Note: No experimental confirmation available.
Length:255
Mass (Da):27,686
Last modified:October 31, 2006 - v2
Checksum:i352B48C29097B226
GO
Isoform 2 (identifier: Q6NZE7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     154-154: S → SS

Note: No experimental confirmation available.
Show »
Length:256
Mass (Da):27,773
Checksum:iE64A8265522B2DF8
GO
Isoform 3 (identifier: Q6NZE7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     208-255: CSDILDGSSISSGLSSDSLATGSAPAESPVACSNSCSPFILMDDLSPK → WWCYQGEEIPALTRCVEHLQMNE

Note: No experimental confirmation available.
Show »
Length:230
Mass (Da):25,801
Checksum:i3090325B2BC39357
GO
Isoform 4 (identifier: Q6NZE7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     208-255: CSDILDGSSISSGLSSDSLATGSAPAESPVACSNSCSPFILMDDLSPK → WWGSLHGGVSDFE

Note: No experimental confirmation available.
Show »
Length:220
Mass (Da):24,441
Checksum:i6F68E34185E4AFFE
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti64D → G in BAC32133 (PubMed:16141072).Curated1
Sequence conflicti94D → G in AAH66167 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_021219154S → SS in isoform 2. 1 Publication1
Alternative sequenceiVSP_021220208 – 255CSDIL…DLSPK → WWCYQGEEIPALTRCVEHLQ MNE in isoform 3. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_021221208 – 255CSDIL…DLSPK → WWGSLHGGVSDFE in isoform 4. 1 PublicationAdd BLAST48

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK019480 mRNA. Translation: BAB31749.1.
AK036417 mRNA. Translation: BAC29421.1.
AK044896 mRNA. Translation: BAC32133.1.
BX679674 Genomic DNA. Translation: CAM26569.1.
BX679674 Genomic DNA. Translation: CAM26570.1.
BC066167 mRNA. Translation: AAH66167.1.
CCDSiCCDS30129.1. [Q6NZE7-2]
CCDS53069.1. [Q6NZE7-3]
CCDS53070.1. [Q6NZE7-1]
RefSeqiNP_001159837.2. NM_001166365.2. [Q6NZE7-1]
NP_001160055.1. NM_001166583.1. [Q6NZE7-3]
NP_084443.1. NM_030167.4. [Q6NZE7-2]
UniGeneiMm.28559.

Genome annotation databases

EnsembliENSMUST00000071023; ENSMUSP00000069112; ENSMUSG00000036022. [Q6NZE7-2]
ENSMUST00000114838; ENSMUSP00000110487; ENSMUSG00000036022. [Q6NZE7-1]
ENSMUST00000114841; ENSMUSP00000110490; ENSMUSG00000036022. [Q6NZE7-3]
GeneIDi78755.
KEGGimmu:78755.
UCSCiuc009tev.2. mouse. [Q6NZE7-2]
uc009tew.2. mouse. [Q6NZE7-1]
uc009tex.2. mouse. [Q6NZE7-4]
uc009tey.2. mouse. [Q6NZE7-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK019480 mRNA. Translation: BAB31749.1.
AK036417 mRNA. Translation: BAC29421.1.
AK044896 mRNA. Translation: BAC32133.1.
BX679674 Genomic DNA. Translation: CAM26569.1.
BX679674 Genomic DNA. Translation: CAM26570.1.
BC066167 mRNA. Translation: AAH66167.1.
CCDSiCCDS30129.1. [Q6NZE7-2]
CCDS53069.1. [Q6NZE7-3]
CCDS53070.1. [Q6NZE7-1]
RefSeqiNP_001159837.2. NM_001166365.2. [Q6NZE7-1]
NP_001160055.1. NM_001166583.1. [Q6NZE7-3]
NP_084443.1. NM_030167.4. [Q6NZE7-2]
UniGeneiMm.28559.

3D structure databases

ProteinModelPortaliQ6NZE7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000069112.

PTM databases

iPTMnetiQ6NZE7.
PhosphoSitePlusiQ6NZE7.

Proteomic databases

PaxDbiQ6NZE7.
PRIDEiQ6NZE7.

Protocols and materials databases

DNASUi78755.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000071023; ENSMUSP00000069112; ENSMUSG00000036022. [Q6NZE7-2]
ENSMUST00000114838; ENSMUSP00000110487; ENSMUSG00000036022. [Q6NZE7-1]
ENSMUST00000114841; ENSMUSP00000110490; ENSMUSG00000036022. [Q6NZE7-3]
GeneIDi78755.
KEGGimmu:78755.
UCSCiuc009tev.2. mouse. [Q6NZE7-2]
uc009tew.2. mouse. [Q6NZE7-1]
uc009tex.2. mouse. [Q6NZE7-4]
uc009tey.2. mouse. [Q6NZE7-3]

Organism-specific databases

CTDi159090.
MGIiMGI:1926005. Fam122b.

Phylogenomic databases

eggNOGiENOG410IF6F. Eukaryota.
ENOG410ZUHK. LUCA.
GeneTreeiENSGT00390000015476.
HOGENOMiHOG000294073.
HOVERGENiHBG073694.
InParanoidiQ6NZE7.
OMAiDTSYGGT.
OrthoDBiEOG091G0EDK.
PhylomeDBiQ6NZE7.
TreeFamiTF330808.

Miscellaneous databases

ChiTaRSiFam122b. mouse.
PROiQ6NZE7.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000036022.
ExpressionAtlasiQ6NZE7. baseline and differential.
GenevisibleiQ6NZE7. MM.

Family and domain databases

InterProiIPR026716. FAM122.
[Graphical view]
PANTHERiPTHR22227. PTHR22227. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiF122B_MOUSE
AccessioniPrimary (citable) accession number: Q6NZE7
Secondary accession number(s): B1B0Y4
, B1B0Y5, Q8BRG5, Q8CBB0, Q9D2N2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: October 31, 2006
Last modified: November 2, 2016
This is version 82 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.