Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q6NZE7 (F122B_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 68. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Protein FAM122B
Gene names
Name:Fam122b
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length255 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Sequence similarities

Belongs to the FAM122 family.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
   PTMAcetylation
Phosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
None. [Check GOA]

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q6NZE7-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Note: No experimental confirmation available.
Isoform 2 (identifier: Q6NZE7-2)

The sequence of this isoform differs from the canonical sequence as follows:
     154-154: S → SS
Note: No experimental confirmation available.
Isoform 3 (identifier: Q6NZE7-3)

The sequence of this isoform differs from the canonical sequence as follows:
     208-255: CSDILDGSSISSGLSSDSLATGSAPAESPVACSNSCSPFILMDDLSPK → WWCYQGEEIPALTRCVEHLQMNE
Note: No experimental confirmation available.
Isoform 4 (identifier: Q6NZE7-4)

The sequence of this isoform differs from the canonical sequence as follows:
     208-255: CSDILDGSSISSGLSSDSLATGSAPAESPVACSNSCSPFILMDDLSPK → WWGSLHGGVSDFE
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Initiator methionine11Removed By similarity
Chain2 – 255254Protein FAM122B
PRO_0000254546

Amino acid modifications

Modified residue21N-acetylalanine By similarity
Modified residue251Phosphoserine By similarity
Modified residue331Phosphoserine By similarity
Modified residue501Phosphoserine By similarity
Modified residue581Phosphoserine By similarity
Modified residue1121Phosphothreonine By similarity
Modified residue1151Phosphoserine Ref.4
Modified residue1191Phosphoserine By similarity
Modified residue1451Phosphoserine By similarity

Natural variations

Alternative sequence1541S → SS in isoform 2.
VSP_021219
Alternative sequence208 – 25548CSDIL…DLSPK → WWCYQGEEIPALTRCVEHLQ MNE in isoform 3.
VSP_021220
Alternative sequence208 – 25548CSDIL…DLSPK → WWGSLHGGVSDFE in isoform 4.
VSP_021221

Experimental info

Sequence conflict641D → G in BAC32133. Ref.1
Sequence conflict941D → G in AAH66167. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 31, 2006. Version 2.
Checksum: 352B48C29097B226

FASTA25527,686
        10         20         30         40         50         60 
MAQEKMDLDF EADTSEGATL RRSNSAPLIH VLSDLSQVFE PYPLRTGRTS TAIMSHHSLE 

        70         80         90        100        110        120 
EGLDMMNRET TNEREAQAGM QISQSWDESL SLSDSDFDKP EKLYSPKRID FTPVSPAPSP 

       130        140        150        160        170        180 
TRGFGKQCLS PSLQMFVSSS GMPPSPVLNP RHFSRRSQSP VKCIRPSVLG PLKRKGEMEM 

       190        200        210        220        230        240 
ESQPKRPFQG TTSMLSTNPA QLSDFSSCSD ILDGSSISSG LSSDSLATGS APAESPVACS 

       250 
NSCSPFILMD DLSPK 

« Hide

Isoform 2 [UniParc].

Checksum: E64A8265522B2DF8
Show »

FASTA25627,773
Isoform 3 [UniParc].

Checksum: 3090325B2BC39357
Show »

FASTA23025,801
Isoform 4 [UniParc].

Checksum: 6F68E34185E4AFFE
Show »

FASTA22024,441

References

[1]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4).
Strain: C57BL/6J.
Tissue: Bone and Skin.
[2]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Strain: C57BL/6J.
Tissue: Embryo.
[4]"Large-scale phosphorylation analysis of mouse liver."
Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-115, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Liver.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK019480 mRNA. Translation: BAB31749.1.
AK036417 mRNA. Translation: BAC29421.1.
AK044896 mRNA. Translation: BAC32133.1.
BX679674 Genomic DNA. Translation: CAM26569.1.
BX679674 Genomic DNA. Translation: CAM26570.1.
BC066167 mRNA. Translation: AAH66167.1.
CCDSCCDS30129.1. [Q6NZE7-2]
CCDS53069.1. [Q6NZE7-3]
CCDS53070.1. [Q6NZE7-1]
RefSeqNP_001159837.2. NM_001166365.2. [Q6NZE7-1]
NP_001160055.1. NM_001166583.1. [Q6NZE7-3]
NP_084443.1. NM_030167.4. [Q6NZE7-2]
UniGeneMm.28559.

3D structure databases

ModBaseSearch...
MobiDBSearch...

PTM databases

PhosphoSiteQ6NZE7.

Proteomic databases

PRIDEQ6NZE7.

Protocols and materials databases

DNASU78755.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000071023; ENSMUSP00000069112; ENSMUSG00000036022. [Q6NZE7-2]
ENSMUST00000114838; ENSMUSP00000110487; ENSMUSG00000036022. [Q6NZE7-1]
ENSMUST00000114841; ENSMUSP00000110490; ENSMUSG00000036022. [Q6NZE7-3]
GeneID78755.
KEGGmmu:78755.
UCSCuc009tev.2. mouse. [Q6NZE7-2]
uc009tew.2. mouse. [Q6NZE7-1]
uc009tey.2. mouse. [Q6NZE7-3]

Organism-specific databases

CTD159090.
MGIMGI:1926005. Fam122b.

Phylogenomic databases

eggNOGNOG83987.
GeneTreeENSGT00390000015476.
HOGENOMHOG000294073.
HOVERGENHBG073694.
OMAQPYTFRT.
OrthoDBEOG7F24TT.
PhylomeDBQ6NZE7.
TreeFamTF330808.

Gene expression databases

BgeeQ6NZE7.
GenevestigatorQ6NZE7.

Family and domain databases

InterProIPR026716. FAM122.
[Graphical view]
PANTHERPTHR22227. PTHR22227. 1 hit.
ProtoNetSearch...

Other

ChiTaRSFAM122B. mouse.
NextBio349444.
PROQ6NZE7.
SOURCESearch...

Entry information

Entry nameF122B_MOUSE
AccessionPrimary (citable) accession number: Q6NZE7
Secondary accession number(s): B1B0Y4 expand/collapse secondary AC list , B1B0Y5, Q8BRG5, Q8CBB0, Q9D2N2
Entry history
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: October 31, 2006
Last modified: July 9, 2014
This is version 68 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot