Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6NZE7

- F122B_MOUSE

UniProt

Q6NZE7 - F122B_MOUSE

Protein

Protein FAM122B

Gene

Fam122b

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 69 (01 Oct 2014)
      Sequence version 2 (31 Oct 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein FAM122B
    Gene namesi
    Name:Fam122b
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome X

    Organism-specific databases

    MGIiMGI:1926005. Fam122b.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11RemovedBy similarity
    Chaini2 – 255254Protein FAM122BPRO_0000254546Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylalanineBy similarity
    Modified residuei25 – 251PhosphoserineBy similarity
    Modified residuei33 – 331PhosphoserineBy similarity
    Modified residuei50 – 501PhosphoserineBy similarity
    Modified residuei58 – 581PhosphoserineBy similarity
    Modified residuei112 – 1121PhosphothreonineBy similarity
    Modified residuei115 – 1151Phosphoserine1 Publication
    Modified residuei119 – 1191PhosphoserineBy similarity
    Modified residuei145 – 1451PhosphoserineBy similarity

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    PRIDEiQ6NZE7.

    PTM databases

    PhosphoSiteiQ6NZE7.

    Expressioni

    Gene expression databases

    BgeeiQ6NZE7.
    GenevestigatoriQ6NZE7.

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the FAM122 family.Curated

    Phylogenomic databases

    eggNOGiNOG83987.
    GeneTreeiENSGT00390000015476.
    HOGENOMiHOG000294073.
    HOVERGENiHBG073694.
    OMAiQPYTFRT.
    OrthoDBiEOG7F24TT.
    PhylomeDBiQ6NZE7.
    TreeFamiTF330808.

    Family and domain databases

    InterProiIPR026716. FAM122.
    [Graphical view]
    PANTHERiPTHR22227. PTHR22227. 1 hit.

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6NZE7-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAQEKMDLDF EADTSEGATL RRSNSAPLIH VLSDLSQVFE PYPLRTGRTS    50
    TAIMSHHSLE EGLDMMNRET TNEREAQAGM QISQSWDESL SLSDSDFDKP 100
    EKLYSPKRID FTPVSPAPSP TRGFGKQCLS PSLQMFVSSS GMPPSPVLNP 150
    RHFSRRSQSP VKCIRPSVLG PLKRKGEMEM ESQPKRPFQG TTSMLSTNPA 200
    QLSDFSSCSD ILDGSSISSG LSSDSLATGS APAESPVACS NSCSPFILMD 250
    DLSPK 255

    Note: No experimental confirmation available.

    Length:255
    Mass (Da):27,686
    Last modified:October 31, 2006 - v2
    Checksum:i352B48C29097B226
    GO
    Isoform 2 (identifier: Q6NZE7-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         154-154: S → SS

    Note: No experimental confirmation available.

    Show »
    Length:256
    Mass (Da):27,773
    Checksum:iE64A8265522B2DF8
    GO
    Isoform 3 (identifier: Q6NZE7-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         208-255: CSDILDGSSISSGLSSDSLATGSAPAESPVACSNSCSPFILMDDLSPK → WWCYQGEEIPALTRCVEHLQMNE

    Note: No experimental confirmation available.

    Show »
    Length:230
    Mass (Da):25,801
    Checksum:i3090325B2BC39357
    GO
    Isoform 4 (identifier: Q6NZE7-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         208-255: CSDILDGSSISSGLSSDSLATGSAPAESPVACSNSCSPFILMDDLSPK → WWGSLHGGVSDFE

    Note: No experimental confirmation available.

    Show »
    Length:220
    Mass (Da):24,441
    Checksum:i6F68E34185E4AFFE
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti64 – 641D → G in BAC32133. (PubMed:16141072)Curated
    Sequence conflicti94 – 941D → G in AAH66167. (PubMed:15489334)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei154 – 1541S → SS in isoform 2. 1 PublicationVSP_021219
    Alternative sequencei208 – 25548CSDIL…DLSPK → WWCYQGEEIPALTRCVEHLQ MNE in isoform 3. 1 PublicationVSP_021220Add
    BLAST
    Alternative sequencei208 – 25548CSDIL…DLSPK → WWGSLHGGVSDFE in isoform 4. 1 PublicationVSP_021221Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK019480 mRNA. Translation: BAB31749.1.
    AK036417 mRNA. Translation: BAC29421.1.
    AK044896 mRNA. Translation: BAC32133.1.
    BX679674 Genomic DNA. Translation: CAM26569.1.
    BX679674 Genomic DNA. Translation: CAM26570.1.
    BC066167 mRNA. Translation: AAH66167.1.
    CCDSiCCDS30129.1. [Q6NZE7-2]
    CCDS53069.1. [Q6NZE7-3]
    CCDS53070.1. [Q6NZE7-1]
    RefSeqiNP_001159837.2. NM_001166365.2. [Q6NZE7-1]
    NP_001160055.1. NM_001166583.1. [Q6NZE7-3]
    NP_084443.1. NM_030167.4. [Q6NZE7-2]
    UniGeneiMm.28559.

    Genome annotation databases

    EnsembliENSMUST00000071023; ENSMUSP00000069112; ENSMUSG00000036022. [Q6NZE7-2]
    ENSMUST00000114838; ENSMUSP00000110487; ENSMUSG00000036022. [Q6NZE7-1]
    ENSMUST00000114841; ENSMUSP00000110490; ENSMUSG00000036022. [Q6NZE7-3]
    GeneIDi78755.
    KEGGimmu:78755.
    UCSCiuc009tev.2. mouse. [Q6NZE7-2]
    uc009tew.2. mouse. [Q6NZE7-1]
    uc009tey.2. mouse. [Q6NZE7-3]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK019480 mRNA. Translation: BAB31749.1 .
    AK036417 mRNA. Translation: BAC29421.1 .
    AK044896 mRNA. Translation: BAC32133.1 .
    BX679674 Genomic DNA. Translation: CAM26569.1 .
    BX679674 Genomic DNA. Translation: CAM26570.1 .
    BC066167 mRNA. Translation: AAH66167.1 .
    CCDSi CCDS30129.1. [Q6NZE7-2 ]
    CCDS53069.1. [Q6NZE7-3 ]
    CCDS53070.1. [Q6NZE7-1 ]
    RefSeqi NP_001159837.2. NM_001166365.2. [Q6NZE7-1 ]
    NP_001160055.1. NM_001166583.1. [Q6NZE7-3 ]
    NP_084443.1. NM_030167.4. [Q6NZE7-2 ]
    UniGenei Mm.28559.

    3D structure databases

    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei Q6NZE7.

    Proteomic databases

    PRIDEi Q6NZE7.

    Protocols and materials databases

    DNASUi 78755.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000071023 ; ENSMUSP00000069112 ; ENSMUSG00000036022 . [Q6NZE7-2 ]
    ENSMUST00000114838 ; ENSMUSP00000110487 ; ENSMUSG00000036022 . [Q6NZE7-1 ]
    ENSMUST00000114841 ; ENSMUSP00000110490 ; ENSMUSG00000036022 . [Q6NZE7-3 ]
    GeneIDi 78755.
    KEGGi mmu:78755.
    UCSCi uc009tev.2. mouse. [Q6NZE7-2 ]
    uc009tew.2. mouse. [Q6NZE7-1 ]
    uc009tey.2. mouse. [Q6NZE7-3 ]

    Organism-specific databases

    CTDi 159090.
    MGIi MGI:1926005. Fam122b.

    Phylogenomic databases

    eggNOGi NOG83987.
    GeneTreei ENSGT00390000015476.
    HOGENOMi HOG000294073.
    HOVERGENi HBG073694.
    OMAi QPYTFRT.
    OrthoDBi EOG7F24TT.
    PhylomeDBi Q6NZE7.
    TreeFami TF330808.

    Miscellaneous databases

    ChiTaRSi FAM122B. mouse.
    NextBioi 349444.
    PROi Q6NZE7.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q6NZE7.
    Genevestigatori Q6NZE7.

    Family and domain databases

    InterProi IPR026716. FAM122.
    [Graphical view ]
    PANTHERi PTHR22227. PTHR22227. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4).
      Strain: C57BL/6J.
      Tissue: Bone and Skin.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: C57BL/6J.
      Tissue: Embryo.
    4. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-115, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Liver.

    Entry informationi

    Entry nameiF122B_MOUSE
    AccessioniPrimary (citable) accession number: Q6NZE7
    Secondary accession number(s): B1B0Y4
    , B1B0Y5, Q8BRG5, Q8CBB0, Q9D2N2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 31, 2006
    Last sequence update: October 31, 2006
    Last modified: October 1, 2014
    This is version 69 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3