Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6NZE7

- F122B_MOUSE

UniProt

Q6NZE7 - F122B_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protein FAM122B

Gene

Fam122b

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Protein FAM122B
Gene namesi
Name:Fam122b
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome X

Organism-specific databases

MGIiMGI:1926005. Fam122b.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11RemovedBy similarity
Chaini2 – 255254Protein FAM122BPRO_0000254546Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanineBy similarity
Modified residuei25 – 251PhosphoserineBy similarity
Modified residuei33 – 331PhosphoserineBy similarity
Modified residuei50 – 501PhosphoserineBy similarity
Modified residuei58 – 581PhosphoserineBy similarity
Modified residuei112 – 1121PhosphothreonineBy similarity
Modified residuei115 – 1151Phosphoserine1 Publication
Modified residuei119 – 1191PhosphoserineBy similarity
Modified residuei145 – 1451PhosphoserineBy similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PRIDEiQ6NZE7.

PTM databases

PhosphoSiteiQ6NZE7.

Expressioni

Gene expression databases

BgeeiQ6NZE7.
ExpressionAtlasiQ6NZE7. baseline and differential.
GenevestigatoriQ6NZE7.

Family & Domainsi

Sequence similaritiesi

Belongs to the FAM122 family.Curated

Phylogenomic databases

eggNOGiNOG83987.
GeneTreeiENSGT00390000015476.
HOGENOMiHOG000294073.
HOVERGENiHBG073694.
InParanoidiQ6NZE7.
OMAiQPYTFRT.
OrthoDBiEOG7F24TT.
PhylomeDBiQ6NZE7.
TreeFamiTF330808.

Family and domain databases

InterProiIPR026716. FAM122.
[Graphical view]
PANTHERiPTHR22227. PTHR22227. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6NZE7-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAQEKMDLDF EADTSEGATL RRSNSAPLIH VLSDLSQVFE PYPLRTGRTS
60 70 80 90 100
TAIMSHHSLE EGLDMMNRET TNEREAQAGM QISQSWDESL SLSDSDFDKP
110 120 130 140 150
EKLYSPKRID FTPVSPAPSP TRGFGKQCLS PSLQMFVSSS GMPPSPVLNP
160 170 180 190 200
RHFSRRSQSP VKCIRPSVLG PLKRKGEMEM ESQPKRPFQG TTSMLSTNPA
210 220 230 240 250
QLSDFSSCSD ILDGSSISSG LSSDSLATGS APAESPVACS NSCSPFILMD

DLSPK

Note: No experimental confirmation available.

Length:255
Mass (Da):27,686
Last modified:October 31, 2006 - v2
Checksum:i352B48C29097B226
GO
Isoform 2 (identifier: Q6NZE7-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     154-154: S → SS

Note: No experimental confirmation available.

Show »
Length:256
Mass (Da):27,773
Checksum:iE64A8265522B2DF8
GO
Isoform 3 (identifier: Q6NZE7-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     208-255: CSDILDGSSISSGLSSDSLATGSAPAESPVACSNSCSPFILMDDLSPK → WWCYQGEEIPALTRCVEHLQMNE

Note: No experimental confirmation available.

Show »
Length:230
Mass (Da):25,801
Checksum:i3090325B2BC39357
GO
Isoform 4 (identifier: Q6NZE7-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     208-255: CSDILDGSSISSGLSSDSLATGSAPAESPVACSNSCSPFILMDDLSPK → WWGSLHGGVSDFE

Note: No experimental confirmation available.

Show »
Length:220
Mass (Da):24,441
Checksum:i6F68E34185E4AFFE
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti64 – 641D → G in BAC32133. (PubMed:16141072)Curated
Sequence conflicti94 – 941D → G in AAH66167. (PubMed:15489334)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei154 – 1541S → SS in isoform 2. 1 PublicationVSP_021219
Alternative sequencei208 – 25548CSDIL…DLSPK → WWCYQGEEIPALTRCVEHLQ MNE in isoform 3. 1 PublicationVSP_021220Add
BLAST
Alternative sequencei208 – 25548CSDIL…DLSPK → WWGSLHGGVSDFE in isoform 4. 1 PublicationVSP_021221Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK019480 mRNA. Translation: BAB31749.1.
AK036417 mRNA. Translation: BAC29421.1.
AK044896 mRNA. Translation: BAC32133.1.
BX679674 Genomic DNA. Translation: CAM26569.1.
BX679674 Genomic DNA. Translation: CAM26570.1.
BC066167 mRNA. Translation: AAH66167.1.
CCDSiCCDS30129.1. [Q6NZE7-2]
CCDS53069.1. [Q6NZE7-3]
CCDS53070.1. [Q6NZE7-1]
RefSeqiNP_001159837.2. NM_001166365.2. [Q6NZE7-1]
NP_001160055.1. NM_001166583.1. [Q6NZE7-3]
NP_084443.1. NM_030167.4. [Q6NZE7-2]
UniGeneiMm.28559.

Genome annotation databases

EnsembliENSMUST00000071023; ENSMUSP00000069112; ENSMUSG00000036022. [Q6NZE7-2]
ENSMUST00000114838; ENSMUSP00000110487; ENSMUSG00000036022. [Q6NZE7-1]
ENSMUST00000114841; ENSMUSP00000110490; ENSMUSG00000036022. [Q6NZE7-3]
GeneIDi78755.
KEGGimmu:78755.
UCSCiuc009tev.2. mouse. [Q6NZE7-2]
uc009tew.2. mouse. [Q6NZE7-1]
uc009tey.2. mouse. [Q6NZE7-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK019480 mRNA. Translation: BAB31749.1 .
AK036417 mRNA. Translation: BAC29421.1 .
AK044896 mRNA. Translation: BAC32133.1 .
BX679674 Genomic DNA. Translation: CAM26569.1 .
BX679674 Genomic DNA. Translation: CAM26570.1 .
BC066167 mRNA. Translation: AAH66167.1 .
CCDSi CCDS30129.1. [Q6NZE7-2 ]
CCDS53069.1. [Q6NZE7-3 ]
CCDS53070.1. [Q6NZE7-1 ]
RefSeqi NP_001159837.2. NM_001166365.2. [Q6NZE7-1 ]
NP_001160055.1. NM_001166583.1. [Q6NZE7-3 ]
NP_084443.1. NM_030167.4. [Q6NZE7-2 ]
UniGenei Mm.28559.

3D structure databases

ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei Q6NZE7.

Proteomic databases

PRIDEi Q6NZE7.

Protocols and materials databases

DNASUi 78755.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000071023 ; ENSMUSP00000069112 ; ENSMUSG00000036022 . [Q6NZE7-2 ]
ENSMUST00000114838 ; ENSMUSP00000110487 ; ENSMUSG00000036022 . [Q6NZE7-1 ]
ENSMUST00000114841 ; ENSMUSP00000110490 ; ENSMUSG00000036022 . [Q6NZE7-3 ]
GeneIDi 78755.
KEGGi mmu:78755.
UCSCi uc009tev.2. mouse. [Q6NZE7-2 ]
uc009tew.2. mouse. [Q6NZE7-1 ]
uc009tey.2. mouse. [Q6NZE7-3 ]

Organism-specific databases

CTDi 159090.
MGIi MGI:1926005. Fam122b.

Phylogenomic databases

eggNOGi NOG83987.
GeneTreei ENSGT00390000015476.
HOGENOMi HOG000294073.
HOVERGENi HBG073694.
InParanoidi Q6NZE7.
OMAi QPYTFRT.
OrthoDBi EOG7F24TT.
PhylomeDBi Q6NZE7.
TreeFami TF330808.

Miscellaneous databases

ChiTaRSi Fam122b. mouse.
NextBioi 349444.
PROi Q6NZE7.
SOURCEi Search...

Gene expression databases

Bgeei Q6NZE7.
ExpressionAtlasi Q6NZE7. baseline and differential.
Genevestigatori Q6NZE7.

Family and domain databases

InterProi IPR026716. FAM122.
[Graphical view ]
PANTHERi PTHR22227. PTHR22227. 1 hit.
ProtoNeti Search...

Publicationsi

  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4).
    Strain: C57BL/6J.
    Tissue: Bone and Skin.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Embryo.
  4. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-115, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiF122B_MOUSE
AccessioniPrimary (citable) accession number: Q6NZE7
Secondary accession number(s): B1B0Y4
, B1B0Y5, Q8BRG5, Q8CBB0, Q9D2N2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: October 31, 2006
Last modified: November 26, 2014
This is version 71 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3