Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6NYL5

- ALAT2_DANRE

UniProt

Q6NYL5 - ALAT2_DANRE

Protein

Alanine aminotransferase 2-like

Gene

gpt2l

Organism
Danio rerio (Zebrafish) (Brachydanio rerio)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 72 (01 Oct 2014)
      Sequence version 2 (04 Dec 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalyzes the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate.By similarity

    Catalytic activityi

    L-alanine + 2-oxoglutarate = pyruvate + L-glutamate.

    Cofactori

    Pyridoxal phosphate.By similarity

    Pathwayi

    GO - Molecular functioni

    1. L-alanine:2-oxoglutarate aminotransferase activity Source: UniProtKB
    2. pyridoxal phosphate binding Source: InterPro

    GO - Biological processi

    1. 2-oxoglutarate metabolic process Source: UniProtKB
    2. biosynthetic process Source: InterPro
    3. L-alanine catabolic process Source: UniProtKB-UniPathway
    4. L-alanine metabolic process Source: UniProtKB

    Keywords - Molecular functioni

    Aminotransferase, Transferase

    Keywords - Ligandi

    Pyridoxal phosphate

    Enzyme and pathway databases

    UniPathwayiUPA00528; UER00586.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Alanine aminotransferase 2-like (EC:2.6.1.2)
    Short name:
    ALT2
    Alternative name(s):
    Glutamate pyruvate transaminase 2
    Short name:
    GPT 2
    Glutamic--alanine transaminase 2
    Glutamic--pyruvic transaminase 2
    Gene namesi
    Name:gpt2l
    Synonyms:gpt2
    ORF Names:im:6791811, si:ch211-261f3.4
    OrganismiDanio rerio (Zebrafish) (Brachydanio rerio)
    Taxonomic identifieri7955 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiActinopterygiiNeopterygiiTeleosteiOstariophysiCypriniformesCyprinidaeDanio
    ProteomesiUP000000437: Unplaced

    Organism-specific databases

    ZFINiZDB-GENE-050302-11. gpt2l.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 549549Alanine aminotransferase 2-likePRO_0000247534Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei367 – 3671N6-(pyridoxal phosphate)lysineBy similarity

    Expressioni

    Gene expression databases

    BgeeiQ6NYL5.

    Interactioni

    Subunit structurei

    Homodimer.By similarity

    Structurei

    3D structure databases

    ProteinModelPortaliQ6NYL5.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Phylogenomic databases

    eggNOGiCOG0436.
    HOVERGENiHBG026148.
    InParanoidiQ6NYL5.
    PhylomeDBiQ6NYL5.

    Family and domain databases

    Gene3Di3.40.640.10. 1 hit.
    3.90.1150.10. 1 hit.
    InterProiIPR004839. Aminotransferase_I/II.
    IPR015424. PyrdxlP-dep_Trfase.
    IPR015421. PyrdxlP-dep_Trfase_major_sub1.
    IPR015422. PyrdxlP-dep_Trfase_major_sub2.
    [Graphical view]
    PfamiPF00155. Aminotran_1_2. 1 hit.
    [Graphical view]
    SUPFAMiSSF53383. SSF53383. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6NYL5-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLSKRSLRVL KWGRCEAAYA AAYPKVPDWV LNFSPLPSLS SPHRDFSAFP    50
    AAQSEHMQQK MSENGAIPRQ GKVLTVDTMN ANVKKVDYAV RGPIVQRAVQ 100
    IEKELKEGVK KPFDEVIKAN IGDAHAMGQR PITFFRQVMA LCTYPQLLDD 150
    NKFPEDAKNR ARRILQSCGG NSIGAYTTSQ GIDCVRQDVA KYIERRDGGI 200
    PSDPDNIYLT TGASDGIVTI LKLLTAGEGL TRTGVMISIP QYPLYSASIA 250
    ELGAVQINYY LNEEKCWSLD ISELQRSLQA ARKHCNPRVL CIINPGNPTG 300
    QVQSRQCIED VIQFAAKENL FLMADEVYQD NVYAKGCEFH SFKKVLFEMG 350
    PEYSKKVELA SFHSTSKCYM GECGFRGGYM EVINMDADVK AQLTKLVSVR 400
    LCPPAPGQAL MDLVVNPPQP GEPSHQTFMQ ERTAVLSALA EKAKLTEQIL 450
    NTVPGISCNP VQGAMYSFPR ITLPERAISE AKAKGQAPDM FYCMKLLEET 500
    GICLVPGSGF GQREGTYHFR MTILPPTDKL KLMLNKLKDF HQRFTQQYS 549

    Note: No experimental confirmation available.

    Length:549
    Mass (Da):61,092
    Last modified:December 4, 2007 - v2
    Checksum:i633DDE9C6F3305D9
    GO
    Isoform 2 (identifier: Q6NYL5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-44: MLSKRSLRVLKWGRCEAAYAAAYPKVPDWVLNFSPLPSLSSPHR → ADLSLLSVVSATEEAPLLHFW

    Note: Incomplete sequence. No experimental confirmation available.

    Show »
    Length:526
    Mass (Da):58,391
    Checksum:i3B32A4C76906FA0B
    GO

    Sequence cautioni

    The sequence CAM14165.1 differs from that shown. Reason: Erroneous gene model prediction.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti57 – 571M → L in AAH66543. 1 PublicationCurated
    Sequence conflicti57 – 571M → L in AAH61955. 1 PublicationCurated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 4444MLSKR…SSPHR → ADLSLLSVVSATEEAPLLHF W in isoform 2. 1 PublicationVSP_029840Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    BX928742 Genomic DNA. Translation: CAM14165.1. Sequence problems.
    BC061955 mRNA. Translation: AAH61955.1.
    BC066543 mRNA. Translation: AAH66543.1.
    UniGeneiDr.33603.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    BX928742 Genomic DNA. Translation: CAM14165.1 . Sequence problems.
    BC061955 mRNA. Translation: AAH61955.1 .
    BC066543 mRNA. Translation: AAH66543.1 .
    UniGenei Dr.33603.

    3D structure databases

    ProteinModelPortali Q6NYL5.
    ModBasei Search...
    MobiDBi Search...

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Organism-specific databases

    ZFINi ZDB-GENE-050302-11. gpt2l.

    Phylogenomic databases

    eggNOGi COG0436.
    HOVERGENi HBG026148.
    InParanoidi Q6NYL5.
    PhylomeDBi Q6NYL5.

    Enzyme and pathway databases

    UniPathwayi UPA00528 ; UER00586 .

    Gene expression databases

    Bgeei Q6NYL5.

    Family and domain databases

    Gene3Di 3.40.640.10. 1 hit.
    3.90.1150.10. 1 hit.
    InterProi IPR004839. Aminotransferase_I/II.
    IPR015424. PyrdxlP-dep_Trfase.
    IPR015421. PyrdxlP-dep_Trfase_major_sub1.
    IPR015422. PyrdxlP-dep_Trfase_major_sub2.
    [Graphical view ]
    Pfami PF00155. Aminotran_1_2. 1 hit.
    [Graphical view ]
    SUPFAMi SSF53383. SSF53383. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "The zebrafish reference genome sequence and its relationship to the human genome."
      Howe K., Clark M.D., Torroja C.F., Torrance J., Berthelot C., Muffato M., Collins J.E., Humphray S., McLaren K., Matthews L., McLaren S., Sealy I., Caccamo M., Churcher C., Scott C., Barrett J.C., Koch R., Rauch G.J.
      , White S., Chow W., Kilian B., Quintais L.T., Guerra-Assuncao J.A., Zhou Y., Gu Y., Yen J., Vogel J.H., Eyre T., Redmond S., Banerjee R., Chi J., Fu B., Langley E., Maguire S.F., Laird G.K., Lloyd D., Kenyon E., Donaldson S., Sehra H., Almeida-King J., Loveland J., Trevanion S., Jones M., Quail M., Willey D., Hunt A., Burton J., Sims S., McLay K., Plumb B., Davis J., Clee C., Oliver K., Clark R., Riddle C., Eliott D., Threadgold G., Harden G., Ware D., Mortimer B., Kerry G., Heath P., Phillimore B., Tracey A., Corby N., Dunn M., Johnson C., Wood J., Clark S., Pelan S., Griffiths G., Smith M., Glithero R., Howden P., Barker N., Stevens C., Harley J., Holt K., Panagiotidis G., Lovell J., Beasley H., Henderson C., Gordon D., Auger K., Wright D., Collins J., Raisen C., Dyer L., Leung K., Robertson L., Ambridge K., Leongamornlert D., McGuire S., Gilderthorp R., Griffiths C., Manthravadi D., Nichol S., Barker G., Whitehead S., Kay M., Brown J., Murnane C., Gray E., Humphries M., Sycamore N., Barker D., Saunders D., Wallis J., Babbage A., Hammond S., Mashreghi-Mohammadi M., Barr L., Martin S., Wray P., Ellington A., Matthews N., Ellwood M., Woodmansey R., Clark G., Cooper J., Tromans A., Grafham D., Skuce C., Pandian R., Andrews R., Harrison E., Kimberley A., Garnett J., Fosker N., Hall R., Garner P., Kelly D., Bird C., Palmer S., Gehring I., Berger A., Dooley C.M., Ersan-Urun Z., Eser C., Geiger H., Geisler M., Karotki L., Kirn A., Konantz J., Konantz M., Oberlander M., Rudolph-Geiger S., Teucke M., Osoegawa K., Zhu B., Rapp A., Widaa S., Langford C., Yang F., Carter N.P., Harrow J., Ning Z., Herrero J., Searle S.M., Enright A., Geisler R., Plasterk R.H., Lee C., Westerfield M., de Jong P.J., Zon L.I., Postlethwait J.H., Nusslein-Volhard C., Hubbard T.J., Roest Crollius H., Rogers J., Stemple D.L.
      Nature 496:498-503(2013) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: Tuebingen.
    2. NIH - Zebrafish Gene Collection (ZGC) project
      Submitted (FEB-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Kidney.

    Entry informationi

    Entry nameiALAT2_DANRE
    AccessioniPrimary (citable) accession number: Q6NYL5
    Secondary accession number(s): A2BII0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 25, 2006
    Last sequence update: December 4, 2007
    Last modified: October 1, 2014
    This is version 72 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3