Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6NYL5

- ALAT2_DANRE

UniProt

Q6NYL5 - ALAT2_DANRE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Alanine aminotransferase 2-like

Gene

gpt2l

Organism
Danio rerio (Zebrafish) (Brachydanio rerio)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli

Functioni

Catalyzes the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate.By similarity

Catalytic activityi

L-alanine + 2-oxoglutarate = pyruvate + L-glutamate.

Cofactori

Pathwayi

GO - Molecular functioni

  1. L-alanine:2-oxoglutarate aminotransferase activity Source: UniProtKB
  2. pyridoxal phosphate binding Source: InterPro

GO - Biological processi

  1. 2-oxoglutarate metabolic process Source: UniProtKB
  2. biosynthetic process Source: InterPro
  3. L-alanine catabolic process Source: UniProtKB-UniPathway
  4. L-alanine metabolic process Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Aminotransferase, Transferase

Keywords - Ligandi

Pyridoxal phosphate

Enzyme and pathway databases

UniPathwayiUPA00528; UER00586.

Names & Taxonomyi

Protein namesi
Recommended name:
Alanine aminotransferase 2-like (EC:2.6.1.2)
Short name:
ALT2
Alternative name(s):
Glutamate pyruvate transaminase 2
Short name:
GPT 2
Glutamic--alanine transaminase 2
Glutamic--pyruvic transaminase 2
Gene namesi
Name:gpt2l
Synonyms:gpt2
ORF Names:im:6791811, si:ch211-261f3.4
OrganismiDanio rerio (Zebrafish) (Brachydanio rerio)
Taxonomic identifieri7955 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiActinopterygiiNeopterygiiTeleosteiOstariophysiCypriniformesCyprinidaeDanio
ProteomesiUP000000437: Unplaced

Organism-specific databases

ZFINiZDB-GENE-050302-11. gpt2l.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 549549Alanine aminotransferase 2-likePRO_0000247534Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei367 – 3671N6-(pyridoxal phosphate)lysineBy similarity

Expressioni

Gene expression databases

BgeeiQ6NYL5.

Interactioni

Subunit structurei

Homodimer.By similarity

Structurei

3D structure databases

ProteinModelPortaliQ6NYL5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG0436.
HOVERGENiHBG026148.
InParanoidiQ6NYL5.
PhylomeDBiQ6NYL5.

Family and domain databases

Gene3Di3.40.640.10. 1 hit.
3.90.1150.10. 1 hit.
InterProiIPR004839. Aminotransferase_I/II.
IPR015424. PyrdxlP-dep_Trfase.
IPR015421. PyrdxlP-dep_Trfase_major_sub1.
IPR015422. PyrdxlP-dep_Trfase_major_sub2.
[Graphical view]
PfamiPF00155. Aminotran_1_2. 1 hit.
[Graphical view]
SUPFAMiSSF53383. SSF53383. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6NYL5-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLSKRSLRVL KWGRCEAAYA AAYPKVPDWV LNFSPLPSLS SPHRDFSAFP
60 70 80 90 100
AAQSEHMQQK MSENGAIPRQ GKVLTVDTMN ANVKKVDYAV RGPIVQRAVQ
110 120 130 140 150
IEKELKEGVK KPFDEVIKAN IGDAHAMGQR PITFFRQVMA LCTYPQLLDD
160 170 180 190 200
NKFPEDAKNR ARRILQSCGG NSIGAYTTSQ GIDCVRQDVA KYIERRDGGI
210 220 230 240 250
PSDPDNIYLT TGASDGIVTI LKLLTAGEGL TRTGVMISIP QYPLYSASIA
260 270 280 290 300
ELGAVQINYY LNEEKCWSLD ISELQRSLQA ARKHCNPRVL CIINPGNPTG
310 320 330 340 350
QVQSRQCIED VIQFAAKENL FLMADEVYQD NVYAKGCEFH SFKKVLFEMG
360 370 380 390 400
PEYSKKVELA SFHSTSKCYM GECGFRGGYM EVINMDADVK AQLTKLVSVR
410 420 430 440 450
LCPPAPGQAL MDLVVNPPQP GEPSHQTFMQ ERTAVLSALA EKAKLTEQIL
460 470 480 490 500
NTVPGISCNP VQGAMYSFPR ITLPERAISE AKAKGQAPDM FYCMKLLEET
510 520 530 540
GICLVPGSGF GQREGTYHFR MTILPPTDKL KLMLNKLKDF HQRFTQQYS

Note: No experimental confirmation available.

Length:549
Mass (Da):61,092
Last modified:December 4, 2007 - v2
Checksum:i633DDE9C6F3305D9
GO
Isoform 2 (identifier: Q6NYL5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-44: MLSKRSLRVLKWGRCEAAYAAAYPKVPDWVLNFSPLPSLSSPHR → ADLSLLSVVSATEEAPLLHFW

Note: Incomplete sequence. No experimental confirmation available.

Show »
Length:526
Mass (Da):58,391
Checksum:i3B32A4C76906FA0B
GO

Sequence cautioni

The sequence CAM14165.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti57 – 571M → L in AAH66543. 1 PublicationCurated
Sequence conflicti57 – 571M → L in AAH61955. 1 PublicationCurated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4444MLSKR…SSPHR → ADLSLLSVVSATEEAPLLHF W in isoform 2. 1 PublicationVSP_029840Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BX928742 Genomic DNA. Translation: CAM14165.1. Sequence problems.
BC061955 mRNA. Translation: AAH61955.1.
BC066543 mRNA. Translation: AAH66543.1.
UniGeneiDr.33603.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BX928742 Genomic DNA. Translation: CAM14165.1 . Sequence problems.
BC061955 mRNA. Translation: AAH61955.1 .
BC066543 mRNA. Translation: AAH66543.1 .
UniGenei Dr.33603.

3D structure databases

ProteinModelPortali Q6NYL5.
ModBasei Search...
MobiDBi Search...

Protocols and materials databases

Structural Biology Knowledgebase Search...

Organism-specific databases

ZFINi ZDB-GENE-050302-11. gpt2l.

Phylogenomic databases

eggNOGi COG0436.
HOVERGENi HBG026148.
InParanoidi Q6NYL5.
PhylomeDBi Q6NYL5.

Enzyme and pathway databases

UniPathwayi UPA00528 ; UER00586 .

Gene expression databases

Bgeei Q6NYL5.

Family and domain databases

Gene3Di 3.40.640.10. 1 hit.
3.90.1150.10. 1 hit.
InterProi IPR004839. Aminotransferase_I/II.
IPR015424. PyrdxlP-dep_Trfase.
IPR015421. PyrdxlP-dep_Trfase_major_sub1.
IPR015422. PyrdxlP-dep_Trfase_major_sub2.
[Graphical view ]
Pfami PF00155. Aminotran_1_2. 1 hit.
[Graphical view ]
SUPFAMi SSF53383. SSF53383. 1 hit.
ProtoNeti Search...

Publicationsi

  1. "The zebrafish reference genome sequence and its relationship to the human genome."
    Howe K., Clark M.D., Torroja C.F., Torrance J., Berthelot C., Muffato M., Collins J.E., Humphray S., McLaren K., Matthews L., McLaren S., Sealy I., Caccamo M., Churcher C., Scott C., Barrett J.C., Koch R., Rauch G.J.
    , White S., Chow W., Kilian B., Quintais L.T., Guerra-Assuncao J.A., Zhou Y., Gu Y., Yen J., Vogel J.H., Eyre T., Redmond S., Banerjee R., Chi J., Fu B., Langley E., Maguire S.F., Laird G.K., Lloyd D., Kenyon E., Donaldson S., Sehra H., Almeida-King J., Loveland J., Trevanion S., Jones M., Quail M., Willey D., Hunt A., Burton J., Sims S., McLay K., Plumb B., Davis J., Clee C., Oliver K., Clark R., Riddle C., Eliott D., Threadgold G., Harden G., Ware D., Mortimer B., Kerry G., Heath P., Phillimore B., Tracey A., Corby N., Dunn M., Johnson C., Wood J., Clark S., Pelan S., Griffiths G., Smith M., Glithero R., Howden P., Barker N., Stevens C., Harley J., Holt K., Panagiotidis G., Lovell J., Beasley H., Henderson C., Gordon D., Auger K., Wright D., Collins J., Raisen C., Dyer L., Leung K., Robertson L., Ambridge K., Leongamornlert D., McGuire S., Gilderthorp R., Griffiths C., Manthravadi D., Nichol S., Barker G., Whitehead S., Kay M., Brown J., Murnane C., Gray E., Humphries M., Sycamore N., Barker D., Saunders D., Wallis J., Babbage A., Hammond S., Mashreghi-Mohammadi M., Barr L., Martin S., Wray P., Ellington A., Matthews N., Ellwood M., Woodmansey R., Clark G., Cooper J., Tromans A., Grafham D., Skuce C., Pandian R., Andrews R., Harrison E., Kimberley A., Garnett J., Fosker N., Hall R., Garner P., Kelly D., Bird C., Palmer S., Gehring I., Berger A., Dooley C.M., Ersan-Urun Z., Eser C., Geiger H., Geisler M., Karotki L., Kirn A., Konantz J., Konantz M., Oberlander M., Rudolph-Geiger S., Teucke M., Osoegawa K., Zhu B., Rapp A., Widaa S., Langford C., Yang F., Carter N.P., Harrow J., Ning Z., Herrero J., Searle S.M., Enright A., Geisler R., Plasterk R.H., Lee C., Westerfield M., de Jong P.J., Zon L.I., Postlethwait J.H., Nusslein-Volhard C., Hubbard T.J., Roest Crollius H., Rogers J., Stemple D.L.
    Nature 496:498-503(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: Tuebingen.
  2. NIH - Zebrafish Gene Collection (ZGC) project
    Submitted (FEB-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Kidney.

Entry informationi

Entry nameiALAT2_DANRE
AccessioniPrimary (citable) accession number: Q6NYL5
Secondary accession number(s): A2BII0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: December 4, 2007
Last modified: November 26, 2014
This is version 73 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3