Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Alanine aminotransferase 2-like

Gene

gpt2l

Organism
Danio rerio (Zebrafish) (Brachydanio rerio)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Catalyzes the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate.By similarity

Catalytic activityi

L-alanine + 2-oxoglutarate = pyruvate + L-glutamate.

Cofactori

Pathway:iL-alanine degradation via transaminase pathway

This protein is involved in step 1 of the subpathway that synthesizes pyruvate from L-alanine.
Proteins known to be involved in this subpathway in this organism are:
  1. Alanine aminotransferase 2-like (gpt2l)
This subpathway is part of the pathway L-alanine degradation via transaminase pathway, which is itself part of Amino-acid degradation.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes pyruvate from L-alanine, the pathway L-alanine degradation via transaminase pathway and in Amino-acid degradation.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Aminotransferase, Transferase

Keywords - Ligandi

Pyridoxal phosphate

Enzyme and pathway databases

UniPathwayiUPA00528; UER00586.

Names & Taxonomyi

Protein namesi
Recommended name:
Alanine aminotransferase 2-like (EC:2.6.1.2)
Short name:
ALT2
Alternative name(s):
Glutamate pyruvate transaminase 2
Short name:
GPT 2
Glutamic--alanine transaminase 2
Glutamic--pyruvic transaminase 2
Gene namesi
Name:gpt2l
Synonyms:gpt2
ORF Names:im:6791811, si:ch211-261f3.4
OrganismiDanio rerio (Zebrafish) (Brachydanio rerio)
Taxonomic identifieri7955 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiActinopterygiiNeopterygiiTeleosteiOstariophysiCypriniformesCyprinidaeDanio
ProteomesiUP000000437 Componenti: Unplaced

Organism-specific databases

ZFINiZDB-GENE-050302-11. gpt2l.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 549549Alanine aminotransferase 2-likePRO_0000247534Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei367 – 3671N6-(pyridoxal phosphate)lysineBy similarity

Expressioni

Gene expression databases

BgeeiQ6NYL5.

Interactioni

Subunit structurei

Homodimer.By similarity

Protein-protein interaction databases

STRINGi7955.ENSDARP00000024463.

Structurei

3D structure databases

ProteinModelPortaliQ6NYL5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG0436.
HOVERGENiHBG026148.
InParanoidiQ6NYL5.
PhylomeDBiQ6NYL5.

Family and domain databases

Gene3Di3.40.640.10. 1 hit.
3.90.1150.10. 1 hit.
InterProiIPR004839. Aminotransferase_I/II.
IPR015424. PyrdxlP-dep_Trfase.
IPR015421. PyrdxlP-dep_Trfase_major_sub1.
IPR015422. PyrdxlP-dep_Trfase_major_sub2.
[Graphical view]
PfamiPF00155. Aminotran_1_2. 1 hit.
[Graphical view]
SUPFAMiSSF53383. SSF53383. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6NYL5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLSKRSLRVL KWGRCEAAYA AAYPKVPDWV LNFSPLPSLS SPHRDFSAFP
60 70 80 90 100
AAQSEHMQQK MSENGAIPRQ GKVLTVDTMN ANVKKVDYAV RGPIVQRAVQ
110 120 130 140 150
IEKELKEGVK KPFDEVIKAN IGDAHAMGQR PITFFRQVMA LCTYPQLLDD
160 170 180 190 200
NKFPEDAKNR ARRILQSCGG NSIGAYTTSQ GIDCVRQDVA KYIERRDGGI
210 220 230 240 250
PSDPDNIYLT TGASDGIVTI LKLLTAGEGL TRTGVMISIP QYPLYSASIA
260 270 280 290 300
ELGAVQINYY LNEEKCWSLD ISELQRSLQA ARKHCNPRVL CIINPGNPTG
310 320 330 340 350
QVQSRQCIED VIQFAAKENL FLMADEVYQD NVYAKGCEFH SFKKVLFEMG
360 370 380 390 400
PEYSKKVELA SFHSTSKCYM GECGFRGGYM EVINMDADVK AQLTKLVSVR
410 420 430 440 450
LCPPAPGQAL MDLVVNPPQP GEPSHQTFMQ ERTAVLSALA EKAKLTEQIL
460 470 480 490 500
NTVPGISCNP VQGAMYSFPR ITLPERAISE AKAKGQAPDM FYCMKLLEET
510 520 530 540
GICLVPGSGF GQREGTYHFR MTILPPTDKL KLMLNKLKDF HQRFTQQYS
Note: No experimental confirmation available.
Length:549
Mass (Da):61,092
Last modified:December 4, 2007 - v2
Checksum:i633DDE9C6F3305D9
GO
Isoform 2 (identifier: Q6NYL5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-44: MLSKRSLRVLKWGRCEAAYAAAYPKVPDWVLNFSPLPSLSSPHR → ADLSLLSVVSATEEAPLLHFW

Note: Incomplete sequence. No experimental confirmation available.
Show »
Length:526
Mass (Da):58,391
Checksum:i3B32A4C76906FA0B
GO

Sequence cautioni

The sequence CAM14165.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti57 – 571M → L in AAH66543 (Ref. 2) Curated
Sequence conflicti57 – 571M → L in AAH61955 (Ref. 2) Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4444MLSKR…SSPHR → ADLSLLSVVSATEEAPLLHF W in isoform 2. 1 PublicationVSP_029840Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BX928742 Genomic DNA. Translation: CAM14165.1. Sequence problems.
BC061955 mRNA. Translation: AAH61955.1.
BC066543 mRNA. Translation: AAH66543.1.
UniGeneiDr.33603.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BX928742 Genomic DNA. Translation: CAM14165.1. Sequence problems.
BC061955 mRNA. Translation: AAH61955.1.
BC066543 mRNA. Translation: AAH66543.1.
UniGeneiDr.33603.

3D structure databases

ProteinModelPortaliQ6NYL5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi7955.ENSDARP00000024463.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Organism-specific databases

ZFINiZDB-GENE-050302-11. gpt2l.

Phylogenomic databases

eggNOGiCOG0436.
HOVERGENiHBG026148.
InParanoidiQ6NYL5.
PhylomeDBiQ6NYL5.

Enzyme and pathway databases

UniPathwayiUPA00528; UER00586.

Miscellaneous databases

PROiQ6NYL5.

Gene expression databases

BgeeiQ6NYL5.

Family and domain databases

Gene3Di3.40.640.10. 1 hit.
3.90.1150.10. 1 hit.
InterProiIPR004839. Aminotransferase_I/II.
IPR015424. PyrdxlP-dep_Trfase.
IPR015421. PyrdxlP-dep_Trfase_major_sub1.
IPR015422. PyrdxlP-dep_Trfase_major_sub2.
[Graphical view]
PfamiPF00155. Aminotran_1_2. 1 hit.
[Graphical view]
SUPFAMiSSF53383. SSF53383. 1 hit.
ProtoNetiSearch...

Publicationsi

  1. "The zebrafish reference genome sequence and its relationship to the human genome."
    Howe K., Clark M.D., Torroja C.F., Torrance J., Berthelot C., Muffato M., Collins J.E., Humphray S., McLaren K., Matthews L., McLaren S., Sealy I., Caccamo M., Churcher C., Scott C., Barrett J.C., Koch R., Rauch G.J.
    , White S., Chow W., Kilian B., Quintais L.T., Guerra-Assuncao J.A., Zhou Y., Gu Y., Yen J., Vogel J.H., Eyre T., Redmond S., Banerjee R., Chi J., Fu B., Langley E., Maguire S.F., Laird G.K., Lloyd D., Kenyon E., Donaldson S., Sehra H., Almeida-King J., Loveland J., Trevanion S., Jones M., Quail M., Willey D., Hunt A., Burton J., Sims S., McLay K., Plumb B., Davis J., Clee C., Oliver K., Clark R., Riddle C., Eliott D., Threadgold G., Harden G., Ware D., Mortimer B., Kerry G., Heath P., Phillimore B., Tracey A., Corby N., Dunn M., Johnson C., Wood J., Clark S., Pelan S., Griffiths G., Smith M., Glithero R., Howden P., Barker N., Stevens C., Harley J., Holt K., Panagiotidis G., Lovell J., Beasley H., Henderson C., Gordon D., Auger K., Wright D., Collins J., Raisen C., Dyer L., Leung K., Robertson L., Ambridge K., Leongamornlert D., McGuire S., Gilderthorp R., Griffiths C., Manthravadi D., Nichol S., Barker G., Whitehead S., Kay M., Brown J., Murnane C., Gray E., Humphries M., Sycamore N., Barker D., Saunders D., Wallis J., Babbage A., Hammond S., Mashreghi-Mohammadi M., Barr L., Martin S., Wray P., Ellington A., Matthews N., Ellwood M., Woodmansey R., Clark G., Cooper J., Tromans A., Grafham D., Skuce C., Pandian R., Andrews R., Harrison E., Kimberley A., Garnett J., Fosker N., Hall R., Garner P., Kelly D., Bird C., Palmer S., Gehring I., Berger A., Dooley C.M., Ersan-Urun Z., Eser C., Geiger H., Geisler M., Karotki L., Kirn A., Konantz J., Konantz M., Oberlander M., Rudolph-Geiger S., Teucke M., Osoegawa K., Zhu B., Rapp A., Widaa S., Langford C., Yang F., Carter N.P., Harrow J., Ning Z., Herrero J., Searle S.M., Enright A., Geisler R., Plasterk R.H., Lee C., Westerfield M., de Jong P.J., Zon L.I., Postlethwait J.H., Nusslein-Volhard C., Hubbard T.J., Roest Crollius H., Rogers J., Stemple D.L.
    Nature 496:498-503(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: Tuebingen.
  2. NIH - Zebrafish Gene Collection (ZGC) project
    Submitted (FEB-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Kidney.

Entry informationi

Entry nameiALAT2_DANRE
AccessioniPrimary (citable) accession number: Q6NYL5
Secondary accession number(s): A2BII0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: December 4, 2007
Last modified: June 24, 2015
This is version 76 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.