Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q6NYL5 (ALAT2_DANRE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 71. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Alanine aminotransferase 2-like

Short name=ALT2
EC=2.6.1.2
Alternative name(s):
Glutamate pyruvate transaminase 2
Short name=GPT 2
Glutamic--alanine transaminase 2
Glutamic--pyruvic transaminase 2
Gene names
Name:gpt2l
Synonyms:gpt2
ORF Names:im:6791811, si:ch211-261f3.4
OrganismDanio rerio (Zebrafish) (Brachydanio rerio) [Reference proteome]
Taxonomic identifier7955 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiActinopterygiiNeopterygiiTeleosteiOstariophysiCypriniformesCyprinidaeDanio

Protein attributes

Sequence length549 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Catalyzes the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate By similarity.

Catalytic activity

L-alanine + 2-oxoglutarate = pyruvate + L-glutamate.

Cofactor

Pyridoxal phosphate By similarity.

Pathway

Amino-acid degradation; L-alanine degradation via transaminase pathway; pyruvate from L-alanine: step 1/1.

Subunit structure

Homodimer By similarity.

Sequence similarities

Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family. Alanine aminotransferase subfamily.

Sequence caution

The sequence CAM14165.1 differs from that shown. Reason: Erroneous gene model prediction.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q6NYL5-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Note: No experimental confirmation available.
Isoform 2 (identifier: Q6NYL5-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-44: MLSKRSLRVLKWGRCEAAYAAAYPKVPDWVLNFSPLPSLSSPHR → ADLSLLSVVSATEEAPLLHFW
Note: Incomplete sequence. No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 549549Alanine aminotransferase 2-like
PRO_0000247534

Amino acid modifications

Modified residue3671N6-(pyridoxal phosphate)lysine By similarity

Natural variations

Alternative sequence1 – 4444MLSKR…SSPHR → ADLSLLSVVSATEEAPLLHF W in isoform 2.
VSP_029840

Experimental info

Sequence conflict571M → L in AAH66543. Ref.2
Sequence conflict571M → L in AAH61955. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified December 4, 2007. Version 2.
Checksum: 633DDE9C6F3305D9

FASTA54961,092
        10         20         30         40         50         60 
MLSKRSLRVL KWGRCEAAYA AAYPKVPDWV LNFSPLPSLS SPHRDFSAFP AAQSEHMQQK 

        70         80         90        100        110        120 
MSENGAIPRQ GKVLTVDTMN ANVKKVDYAV RGPIVQRAVQ IEKELKEGVK KPFDEVIKAN 

       130        140        150        160        170        180 
IGDAHAMGQR PITFFRQVMA LCTYPQLLDD NKFPEDAKNR ARRILQSCGG NSIGAYTTSQ 

       190        200        210        220        230        240 
GIDCVRQDVA KYIERRDGGI PSDPDNIYLT TGASDGIVTI LKLLTAGEGL TRTGVMISIP 

       250        260        270        280        290        300 
QYPLYSASIA ELGAVQINYY LNEEKCWSLD ISELQRSLQA ARKHCNPRVL CIINPGNPTG 

       310        320        330        340        350        360 
QVQSRQCIED VIQFAAKENL FLMADEVYQD NVYAKGCEFH SFKKVLFEMG PEYSKKVELA 

       370        380        390        400        410        420 
SFHSTSKCYM GECGFRGGYM EVINMDADVK AQLTKLVSVR LCPPAPGQAL MDLVVNPPQP 

       430        440        450        460        470        480 
GEPSHQTFMQ ERTAVLSALA EKAKLTEQIL NTVPGISCNP VQGAMYSFPR ITLPERAISE 

       490        500        510        520        530        540 
AKAKGQAPDM FYCMKLLEET GICLVPGSGF GQREGTYHFR MTILPPTDKL KLMLNKLKDF 


HQRFTQQYS 

« Hide

Isoform 2 [UniParc].

Checksum: 3B32A4C76906FA0B
Show »

FASTA52658,391

References

[1]"The zebrafish reference genome sequence and its relationship to the human genome."
Howe K., Clark M.D., Torroja C.F., Torrance J., Berthelot C., Muffato M., Collins J.E., Humphray S., McLaren K., Matthews L., McLaren S., Sealy I., Caccamo M., Churcher C., Scott C., Barrett J.C., Koch R., Rauch G.J. expand/collapse author list , White S., Chow W., Kilian B., Quintais L.T., Guerra-Assuncao J.A., Zhou Y., Gu Y., Yen J., Vogel J.H., Eyre T., Redmond S., Banerjee R., Chi J., Fu B., Langley E., Maguire S.F., Laird G.K., Lloyd D., Kenyon E., Donaldson S., Sehra H., Almeida-King J., Loveland J., Trevanion S., Jones M., Quail M., Willey D., Hunt A., Burton J., Sims S., McLay K., Plumb B., Davis J., Clee C., Oliver K., Clark R., Riddle C., Eliott D., Threadgold G., Harden G., Ware D., Mortimer B., Kerry G., Heath P., Phillimore B., Tracey A., Corby N., Dunn M., Johnson C., Wood J., Clark S., Pelan S., Griffiths G., Smith M., Glithero R., Howden P., Barker N., Stevens C., Harley J., Holt K., Panagiotidis G., Lovell J., Beasley H., Henderson C., Gordon D., Auger K., Wright D., Collins J., Raisen C., Dyer L., Leung K., Robertson L., Ambridge K., Leongamornlert D., McGuire S., Gilderthorp R., Griffiths C., Manthravadi D., Nichol S., Barker G., Whitehead S., Kay M., Brown J., Murnane C., Gray E., Humphries M., Sycamore N., Barker D., Saunders D., Wallis J., Babbage A., Hammond S., Mashreghi-Mohammadi M., Barr L., Martin S., Wray P., Ellington A., Matthews N., Ellwood M., Woodmansey R., Clark G., Cooper J., Tromans A., Grafham D., Skuce C., Pandian R., Andrews R., Harrison E., Kimberley A., Garnett J., Fosker N., Hall R., Garner P., Kelly D., Bird C., Palmer S., Gehring I., Berger A., Dooley C.M., Ersan-Urun Z., Eser C., Geiger H., Geisler M., Karotki L., Kirn A., Konantz J., Konantz M., Oberlander M., Rudolph-Geiger S., Teucke M., Osoegawa K., Zhu B., Rapp A., Widaa S., Langford C., Yang F., Carter N.P., Harrow J., Ning Z., Herrero J., Searle S.M., Enright A., Geisler R., Plasterk R.H., Lee C., Westerfield M., de Jong P.J., Zon L.I., Postlethwait J.H., Nusslein-Volhard C., Hubbard T.J., Roest Crollius H., Rogers J., Stemple D.L.
Nature 496:498-503(2013) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: Tuebingen.
[2]NIH - Zebrafish Gene Collection (ZGC) project
Submitted (FEB-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Kidney.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
BX928742 Genomic DNA. Translation: CAM14165.1. Sequence problems.
BC061955 mRNA. Translation: AAH61955.1.
BC066543 mRNA. Translation: AAH66543.1.
UniGeneDr.33603.

3D structure databases

ProteinModelPortalQ6NYL5.
ModBaseSearch...
MobiDBSearch...

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Organism-specific databases

ZFINZDB-GENE-050302-11. gpt2l.

Phylogenomic databases

eggNOGCOG0436.
HOVERGENHBG026148.
InParanoidQ6NYL5.
PhylomeDBQ6NYL5.

Enzyme and pathway databases

UniPathwayUPA00528; UER00586.

Gene expression databases

BgeeQ6NYL5.

Family and domain databases

Gene3D3.40.640.10. 1 hit.
3.90.1150.10. 1 hit.
InterProIPR004839. Aminotransferase_I/II.
IPR015424. PyrdxlP-dep_Trfase.
IPR015421. PyrdxlP-dep_Trfase_major_sub1.
IPR015422. PyrdxlP-dep_Trfase_major_sub2.
[Graphical view]
PfamPF00155. Aminotran_1_2. 1 hit.
[Graphical view]
SUPFAMSSF53383. SSF53383. 1 hit.
ProtoNetSearch...

Entry information

Entry nameALAT2_DANRE
AccessionPrimary (citable) accession number: Q6NYL5
Secondary accession number(s): A2BII0
Entry history
Integrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: December 4, 2007
Last modified: April 16, 2014
This is version 71 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

PATHWAY comments

Index of metabolic and biosynthesis pathways