Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

KN motif and ankyrin repeat domain-containing protein 3

Gene

KANK3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

May be involved in the control of cytoskeleton formation by regulating actin polymerization.

Enzyme and pathway databases

BioCyciZFISH:G66-32674-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
KN motif and ankyrin repeat domain-containing protein 3
Alternative name(s):
Ankyrin repeat domain-containing protein 47
Gene namesi
Name:KANK3
Synonyms:ANKRD47
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:24796. KANK3.

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000186994.
PharmGKBiPA162392612.

Polymorphism and mutation databases

BioMutaiKANK3.
DMDMi74749039.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002445821 – 840KN motif and ankyrin repeat domain-containing protein 3Add BLAST840

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei152PhosphoserineCombined sources1
Modified residuei160PhosphoserineBy similarity1
Modified residuei164PhosphoserineBy similarity1
Modified residuei167PhosphoserineCombined sources1
Modified residuei168PhosphoserineCombined sources1
Modified residuei177PhosphoserineCombined sources1
Modified residuei271PhosphoserineCombined sources1
Modified residuei280PhosphoserineBy similarity1
Modified residuei293PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ6NY19.
PaxDbiQ6NY19.
PeptideAtlasiQ6NY19.
PRIDEiQ6NY19.

PTM databases

iPTMnetiQ6NY19.
PhosphoSitePlusiQ6NY19.

Expressioni

Tissue specificityi

Strongly expressed in breast, liver, lung, skeletal muscle and kidney.1 Publication

Gene expression databases

BgeeiENSG00000186994.
CleanExiHS_KANK3.
ExpressionAtlasiQ6NY19. baseline and differential.
GenevisibleiQ6NY19. HS.

Organism-specific databases

HPAiHPA051153.

Interactioni

Protein-protein interaction databases

IntActiQ6NY19. 1 interactor.
STRINGi9606.ENSP00000328923.

Structurei

3D structure databases

ProteinModelPortaliQ6NY19.
SMRiQ6NY19.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati622 – 652ANK 1Add BLAST31
Repeati656 – 690ANK 2Add BLAST35
Repeati695 – 724ANK 3Add BLAST30
Repeati728 – 758ANK 4Add BLAST31
Repeati762 – 795ANK 5Add BLAST34

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili181 – 230Sequence analysisAdd BLAST50
Coiled coili367 – 404Sequence analysisAdd BLAST38

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi479 – 482Poly-Ser4
Compositional biasi807 – 810Poly-Pro4

Sequence similaritiesi

Contains 5 ANK repeats.PROSITE-ProRule annotation

Keywords - Domaini

ANK repeat, Coiled coil, Repeat

Phylogenomic databases

eggNOGiKOG0514. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00530000063448.
HOGENOMiHOG000060328.
HOVERGENiHBG101217.
InParanoidiQ6NY19.
OMAiSLEHQRG.
OrthoDBiEOG091G0D3F.
PhylomeDBiQ6NY19.
TreeFamiTF324499.

Family and domain databases

Gene3Di1.25.40.20. 1 hit.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR021939. KN_motif.
[Graphical view]
PfamiPF12796. Ank_2. 1 hit.
PF12075. KN_motif. 1 hit.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 4 hits.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6NY19-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAKFALNQNL PDLGGPRLCP VPAAGGARSP SSPYSVETPY GFHLDLDFLK
60 70 80 90 100
YIEELERGPA ARRAPGPPTS RRPRAPRPGL AGARSPGAWT SSESLASDDG
110 120 130 140 150
GAPGILSQGA PSGLLMQPLS PRAPVRNPRV EHTLRETSRR LELAQTHERA
160 170 180 190 200
PSPGRGVPRS PRGSGRSSPA PNLAPASPGP AQLQLVREQM AAALRRLREL
210 220 230 240 250
EDQARTLPEL QEQVRALRAE KARLLAGRAQ PEPDGEAETR PDKLAQLRRL
260 270 280 290 300
TERLATSERG GRARASPRAD SPDGLAAGRS EGALQVLDGE VGSLDGTPQT
310 320 330 340 350
REVAAEAVPE TREAGAQAVP ETREAGVEAA PETVEADAWV TEALLGLPAA
360 370 380 390 400
AERELELLRA SLEHQRGVSE LLRGRLRELE EAREAAEEAA AGARAQLREA
410 420 430 440 450
TTQTPWSCAE KAAQTESPAE APSLTQESSP GSMDGDRAVA PAGILKSIMK
460 470 480 490 500
KRDGTPGAQP SSGPKSLQFV GVLNGEYESS SSEDASDSDG DSENGGAEPP
510 520 530 540 550
GSSSGSGDDS GGGSDSGTPG PPSGGDIRDP EPEAEAEPQQ VAQGRCELSP
560 570 580 590 600
RLREACVALQ RQLSRPRGVA SDGGAVRLVA QEWFRVSSQR RSQAEPVARM
610 620 630 640 650
LEGVRRLGPE LLAHVVNLAD GNGNTALHYS VSHGNLAIAS LLLDTGACEV
660 670 680 690 700
NRQNRAGYSA LMLAALTSVR QEEEDMAVVQ RLFCMGDVNA KASQTGQTAL
710 720 730 740 750
MLAISHGRQD MVATLLACGA DVNAQDADGA TALMCASEYG RLDTVRLLLT
760 770 780 790 800
QPGCDPAILD NEGTSALAIA LEAEQDEVAA LLHAHLSSGQ PDTQAGVQRH
810 820 830 840
NLSSLQPPPP RFKKFSCLSL PSSWDYNSCE PSRLAQLTIF
Length:840
Mass (Da):88,425
Last modified:July 5, 2004 - v1
Checksum:i4F917006B1B0FB66
GO
Isoform 2 (identifier: Q6NY19-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     795-840: AGVQRHNLSSLQPPPPRFKKFSCLSLPSSWDYNSCEPSRLAQLTIF → SESPPGSQTATPGEGECGDNGENPQVQ

Show »
Length:821
Mass (Da):85,893
Checksum:i66CCB7F5B1B251F5
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_026909288D → Y.1 PublicationCorresponds to variant rs890850dbSNPEnsembl.1
Natural variantiVAR_026910359R → H.Corresponds to variant rs890853dbSNPEnsembl.1
Natural variantiVAR_026911485A → T.1 PublicationCorresponds to variant rs2913955dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_019607795 – 840AGVQR…QLTIF → SESPPGSQTATPGEGECGDN GENPQVQ in isoform 2. 2 PublicationsAdd BLAST46

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK128815 mRNA. Translation: BAC87620.1.
BC035849 mRNA. Translation: AAH35849.1.
BC066124 mRNA. Translation: AAH66124.1.
BC066775 mRNA. Translation: AAH66775.1.
CCDSiCCDS12199.1. [Q6NY19-2]
RefSeqiNP_940873.2. NM_198471.2. [Q6NY19-2]
XP_006722781.1. XM_006722718.3. [Q6NY19-2]
XP_011526186.1. XM_011527884.2. [Q6NY19-2]
UniGeneiHs.745036.

Genome annotation databases

EnsembliENST00000330915; ENSP00000328923; ENSG00000186994. [Q6NY19-2]
ENST00000593649; ENSP00000470728; ENSG00000186994. [Q6NY19-1]
GeneIDi256949.
KEGGihsa:256949.
UCSCiuc010dwa.3. human. [Q6NY19-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK128815 mRNA. Translation: BAC87620.1.
BC035849 mRNA. Translation: AAH35849.1.
BC066124 mRNA. Translation: AAH66124.1.
BC066775 mRNA. Translation: AAH66775.1.
CCDSiCCDS12199.1. [Q6NY19-2]
RefSeqiNP_940873.2. NM_198471.2. [Q6NY19-2]
XP_006722781.1. XM_006722718.3. [Q6NY19-2]
XP_011526186.1. XM_011527884.2. [Q6NY19-2]
UniGeneiHs.745036.

3D structure databases

ProteinModelPortaliQ6NY19.
SMRiQ6NY19.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ6NY19. 1 interactor.
STRINGi9606.ENSP00000328923.

PTM databases

iPTMnetiQ6NY19.
PhosphoSitePlusiQ6NY19.

Polymorphism and mutation databases

BioMutaiKANK3.
DMDMi74749039.

Proteomic databases

EPDiQ6NY19.
PaxDbiQ6NY19.
PeptideAtlasiQ6NY19.
PRIDEiQ6NY19.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000330915; ENSP00000328923; ENSG00000186994. [Q6NY19-2]
ENST00000593649; ENSP00000470728; ENSG00000186994. [Q6NY19-1]
GeneIDi256949.
KEGGihsa:256949.
UCSCiuc010dwa.3. human. [Q6NY19-1]

Organism-specific databases

CTDi256949.
GeneCardsiKANK3.
HGNCiHGNC:24796. KANK3.
HPAiHPA051153.
MIMi614611. gene.
neXtProtiNX_Q6NY19.
OpenTargetsiENSG00000186994.
PharmGKBiPA162392612.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0514. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00530000063448.
HOGENOMiHOG000060328.
HOVERGENiHBG101217.
InParanoidiQ6NY19.
OMAiSLEHQRG.
OrthoDBiEOG091G0D3F.
PhylomeDBiQ6NY19.
TreeFamiTF324499.

Enzyme and pathway databases

BioCyciZFISH:G66-32674-MONOMER.

Miscellaneous databases

GenomeRNAii256949.
PROiQ6NY19.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000186994.
CleanExiHS_KANK3.
ExpressionAtlasiQ6NY19. baseline and differential.
GenevisibleiQ6NY19. HS.

Family and domain databases

Gene3Di1.25.40.20. 1 hit.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR021939. KN_motif.
[Graphical view]
PfamiPF12796. Ank_2. 1 hit.
PF12075. KN_motif. 1 hit.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 4 hits.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiKANK3_HUMAN
AccessioniPrimary (citable) accession number: Q6NY19
Secondary accession number(s): Q6NZI1, Q6ZQR3, Q8IUV2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: July 5, 2004
Last modified: November 2, 2016
This is version 116 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.