Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

KN motif and ankyrin repeat domain-containing protein 3

Gene

KANK3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May be involved in the control of cytoskeleton formation by regulating actin polymerization.

Names & Taxonomyi

Protein namesi
Recommended name:
KN motif and ankyrin repeat domain-containing protein 3
Alternative name(s):
Ankyrin repeat domain-containing protein 47
Gene namesi
Name:KANK3
Synonyms:ANKRD47
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000186994.11
HGNCiHGNC:24796 KANK3
MIMi614611 gene
neXtProtiNX_Q6NY19

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000186994
PharmGKBiPA162392612

Polymorphism and mutation databases

BioMutaiKANK3
DMDMi74749039

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002445821 – 840KN motif and ankyrin repeat domain-containing protein 3Add BLAST840

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei152PhosphoserineCombined sources1
Modified residuei160PhosphoserineBy similarity1
Modified residuei164PhosphoserineBy similarity1
Modified residuei167PhosphoserineCombined sources1
Modified residuei168PhosphoserineCombined sources1
Modified residuei177PhosphoserineCombined sources1
Modified residuei271PhosphoserineCombined sources1
Modified residuei280PhosphoserineBy similarity1
Modified residuei293PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ6NY19
PaxDbiQ6NY19
PeptideAtlasiQ6NY19
PRIDEiQ6NY19
ProteomicsDBi66779
66780 [Q6NY19-2]

PTM databases

iPTMnetiQ6NY19
PhosphoSitePlusiQ6NY19

Expressioni

Tissue specificityi

Strongly expressed in breast, liver, lung, skeletal muscle and kidney.1 Publication

Gene expression databases

BgeeiENSG00000186994
CleanExiHS_KANK3
ExpressionAtlasiQ6NY19 baseline and differential
GenevisibleiQ6NY19 HS

Organism-specific databases

HPAiHPA051153

Interactioni

Protein-protein interaction databases

IntActiQ6NY19, 1 interactor
STRINGi9606.ENSP00000328923

Structurei

3D structure databases

ProteinModelPortaliQ6NY19
SMRiQ6NY19
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati622 – 652ANK 1Add BLAST31
Repeati656 – 690ANK 2Add BLAST35
Repeati695 – 724ANK 3Add BLAST30
Repeati728 – 758ANK 4Add BLAST31
Repeati762 – 795ANK 5Add BLAST34

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili181 – 230Sequence analysisAdd BLAST50
Coiled coili367 – 404Sequence analysisAdd BLAST38

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi479 – 482Poly-Ser4
Compositional biasi807 – 810Poly-Pro4

Keywords - Domaini

ANK repeat, Coiled coil, Repeat

Phylogenomic databases

eggNOGiKOG0514 Eukaryota
COG0666 LUCA
GeneTreeiENSGT00530000063448
HOGENOMiHOG000060328
HOVERGENiHBG101217
InParanoidiQ6NY19
OMAiSLEHQRG
OrthoDBiEOG091G0D3F
PhylomeDBiQ6NY19
TreeFamiTF324499

Family and domain databases

CDDicd00204 ANK, 1 hit
Gene3Di1.25.40.20, 1 hit
InterProiView protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR021939 KN_motif
PfamiView protein in Pfam
PF12796 Ank_2, 1 hit
PF12075 KN_motif, 1 hit
PRINTSiPR01415 ANKYRIN
SMARTiView protein in SMART
SM00248 ANK, 4 hits
SUPFAMiSSF48403 SSF48403, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 2 hits

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6NY19-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAKFALNQNL PDLGGPRLCP VPAAGGARSP SSPYSVETPY GFHLDLDFLK
60 70 80 90 100
YIEELERGPA ARRAPGPPTS RRPRAPRPGL AGARSPGAWT SSESLASDDG
110 120 130 140 150
GAPGILSQGA PSGLLMQPLS PRAPVRNPRV EHTLRETSRR LELAQTHERA
160 170 180 190 200
PSPGRGVPRS PRGSGRSSPA PNLAPASPGP AQLQLVREQM AAALRRLREL
210 220 230 240 250
EDQARTLPEL QEQVRALRAE KARLLAGRAQ PEPDGEAETR PDKLAQLRRL
260 270 280 290 300
TERLATSERG GRARASPRAD SPDGLAAGRS EGALQVLDGE VGSLDGTPQT
310 320 330 340 350
REVAAEAVPE TREAGAQAVP ETREAGVEAA PETVEADAWV TEALLGLPAA
360 370 380 390 400
AERELELLRA SLEHQRGVSE LLRGRLRELE EAREAAEEAA AGARAQLREA
410 420 430 440 450
TTQTPWSCAE KAAQTESPAE APSLTQESSP GSMDGDRAVA PAGILKSIMK
460 470 480 490 500
KRDGTPGAQP SSGPKSLQFV GVLNGEYESS SSEDASDSDG DSENGGAEPP
510 520 530 540 550
GSSSGSGDDS GGGSDSGTPG PPSGGDIRDP EPEAEAEPQQ VAQGRCELSP
560 570 580 590 600
RLREACVALQ RQLSRPRGVA SDGGAVRLVA QEWFRVSSQR RSQAEPVARM
610 620 630 640 650
LEGVRRLGPE LLAHVVNLAD GNGNTALHYS VSHGNLAIAS LLLDTGACEV
660 670 680 690 700
NRQNRAGYSA LMLAALTSVR QEEEDMAVVQ RLFCMGDVNA KASQTGQTAL
710 720 730 740 750
MLAISHGRQD MVATLLACGA DVNAQDADGA TALMCASEYG RLDTVRLLLT
760 770 780 790 800
QPGCDPAILD NEGTSALAIA LEAEQDEVAA LLHAHLSSGQ PDTQAGVQRH
810 820 830 840
NLSSLQPPPP RFKKFSCLSL PSSWDYNSCE PSRLAQLTIF
Length:840
Mass (Da):88,425
Last modified:July 5, 2004 - v1
Checksum:i4F917006B1B0FB66
GO
Isoform 2 (identifier: Q6NY19-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     795-840: AGVQRHNLSSLQPPPPRFKKFSCLSLPSSWDYNSCEPSRLAQLTIF → SESPPGSQTATPGEGECGDNGENPQVQ

Show »
Length:821
Mass (Da):85,893
Checksum:i66CCB7F5B1B251F5
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_026909288D → Y1 PublicationCorresponds to variant dbSNP:rs890850Ensembl.1
Natural variantiVAR_026910359R → H. Corresponds to variant dbSNP:rs890853Ensembl.1
Natural variantiVAR_026911485A → T1 PublicationCorresponds to variant dbSNP:rs2913955Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_019607795 – 840AGVQR…QLTIF → SESPPGSQTATPGEGECGDN GENPQVQ in isoform 2. 2 PublicationsAdd BLAST46

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK128815 mRNA Translation: BAC87620.1
BC035849 mRNA Translation: AAH35849.1
BC066124 mRNA Translation: AAH66124.1
BC066775 mRNA Translation: AAH66775.1
CCDSiCCDS12199.1 [Q6NY19-2]
RefSeqiNP_940873.2, NM_198471.2 [Q6NY19-2]
XP_006722781.1, XM_006722718.3 [Q6NY19-2]
XP_011526186.1, XM_011527884.2 [Q6NY19-2]
UniGeneiHs.745036

Genome annotation databases

EnsembliENST00000330915; ENSP00000328923; ENSG00000186994 [Q6NY19-2]
ENST00000593649; ENSP00000470728; ENSG00000186994 [Q6NY19-1]
GeneIDi256949
KEGGihsa:256949
UCSCiuc010dwa.3 human [Q6NY19-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiKANK3_HUMAN
AccessioniPrimary (citable) accession number: Q6NY19
Secondary accession number(s): Q6NZI1, Q6ZQR3, Q8IUV2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: July 5, 2004
Last modified: June 20, 2018
This is version 122 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health