Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q6NY19 (KANK3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 95. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
KN motif and ankyrin repeat domain-containing protein 3
Alternative name(s):
Ankyrin repeat domain-containing protein 47
Gene names
Name:KANK3
Synonyms:ANKRD47
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length840 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

May be involved in the control of cytoskeleton formation by regulating actin polymerization. Ref.3

Tissue specificity

Strongly expressed in breast, liver, lung, skeletal muscle and kidney. Ref.3

Sequence similarities

Contains 5 ANK repeats.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainANK repeat
Coiled coil
Repeat
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
None. [Check GOA]

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q6NY19-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q6NY19-2)

The sequence of this isoform differs from the canonical sequence as follows:
     795-840: AGVQRHNLSSLQPPPPRFKKFSCLSLPSSWDYNSCEPSRLAQLTIF → SESPPGSQTATPGEGECGDNGENPQVQ

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 840840KN motif and ankyrin repeat domain-containing protein 3
PRO_0000244582

Regions

Repeat622 – 65231ANK 1
Repeat656 – 69035ANK 2
Repeat695 – 72430ANK 3
Repeat728 – 75831ANK 4
Repeat762 – 79534ANK 5
Coiled coil181 – 23050 Potential
Coiled coil367 – 40438 Potential
Compositional bias479 – 4824Poly-Ser
Compositional bias807 – 8104Poly-Pro

Natural variations

Alternative sequence795 – 84046AGVQR…QLTIF → SESPPGSQTATPGEGECGDN GENPQVQ in isoform 2.
VSP_019607
Natural variant2881D → Y. Ref.1
Corresponds to variant rs890850 [ dbSNP | Ensembl ].
VAR_026909
Natural variant3591R → H.
Corresponds to variant rs890853 [ dbSNP | Ensembl ].
VAR_026910
Natural variant4851A → T. Ref.1
Corresponds to variant rs2913955 [ dbSNP | Ensembl ].
VAR_026911

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 5, 2004. Version 1.
Checksum: 4F917006B1B0FB66

FASTA84088,425
        10         20         30         40         50         60 
MAKFALNQNL PDLGGPRLCP VPAAGGARSP SSPYSVETPY GFHLDLDFLK YIEELERGPA 

        70         80         90        100        110        120 
ARRAPGPPTS RRPRAPRPGL AGARSPGAWT SSESLASDDG GAPGILSQGA PSGLLMQPLS 

       130        140        150        160        170        180 
PRAPVRNPRV EHTLRETSRR LELAQTHERA PSPGRGVPRS PRGSGRSSPA PNLAPASPGP 

       190        200        210        220        230        240 
AQLQLVREQM AAALRRLREL EDQARTLPEL QEQVRALRAE KARLLAGRAQ PEPDGEAETR 

       250        260        270        280        290        300 
PDKLAQLRRL TERLATSERG GRARASPRAD SPDGLAAGRS EGALQVLDGE VGSLDGTPQT 

       310        320        330        340        350        360 
REVAAEAVPE TREAGAQAVP ETREAGVEAA PETVEADAWV TEALLGLPAA AERELELLRA 

       370        380        390        400        410        420 
SLEHQRGVSE LLRGRLRELE EAREAAEEAA AGARAQLREA TTQTPWSCAE KAAQTESPAE 

       430        440        450        460        470        480 
APSLTQESSP GSMDGDRAVA PAGILKSIMK KRDGTPGAQP SSGPKSLQFV GVLNGEYESS 

       490        500        510        520        530        540 
SSEDASDSDG DSENGGAEPP GSSSGSGDDS GGGSDSGTPG PPSGGDIRDP EPEAEAEPQQ 

       550        560        570        580        590        600 
VAQGRCELSP RLREACVALQ RQLSRPRGVA SDGGAVRLVA QEWFRVSSQR RSQAEPVARM 

       610        620        630        640        650        660 
LEGVRRLGPE LLAHVVNLAD GNGNTALHYS VSHGNLAIAS LLLDTGACEV NRQNRAGYSA 

       670        680        690        700        710        720 
LMLAALTSVR QEEEDMAVVQ RLFCMGDVNA KASQTGQTAL MLAISHGRQD MVATLLACGA 

       730        740        750        760        770        780 
DVNAQDADGA TALMCASEYG RLDTVRLLLT QPGCDPAILD NEGTSALAIA LEAEQDEVAA 

       790        800        810        820        830        840 
LLHAHLSSGQ PDTQAGVQRH NLSSLQPPPP RFKKFSCLSL PSSWDYNSCE PSRLAQLTIF 

« Hide

Isoform 2 [UniParc].

Checksum: 66CCB7F5B1B251F5
Show »

FASTA82185,893

References

« Hide 'large scale' references
[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS TYR-288 AND THR-485.
Tissue: Mammary gland.
[2]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Brain and Placenta.
[3]"Kank proteins: a new family of ankyrin-repeat domain-containing proteins."
Zhu Y., Kakinuma N., Wang Y., Kiyama R.
Biochim. Biophys. Acta 1780:128-133(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: POSSIBLE FUNCTION, TISSUE SPECIFICITY.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK128815 mRNA. Translation: BAC87620.1.
BC035849 mRNA. Translation: AAH35849.1.
BC066124 mRNA. Translation: AAH66124.1.
BC066775 mRNA. Translation: AAH66775.1.
CCDSCCDS12199.1. [Q6NY19-2]
RefSeqNP_940873.2. NM_198471.2. [Q6NY19-2]
XP_006722781.1. XM_006722718.1. [Q6NY19-2]
UniGeneHs.745036.

3D structure databases

ProteinModelPortalQ6NY19.
SMRQ6NY19. Positions 547-787.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid129185. 1 interaction.
IntActQ6NY19. 1 interaction.

PTM databases

PhosphoSiteQ6NY19.

Polymorphism databases

DMDM74749039.

Proteomic databases

PaxDbQ6NY19.
PRIDEQ6NY19.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000330915; ENSP00000328923; ENSG00000186994. [Q6NY19-2]
ENST00000593649; ENSP00000470728; ENSG00000186994. [Q6NY19-1]
GeneID256949.
KEGGhsa:256949.
UCSCuc010dwa.3. human. [Q6NY19-2]

Organism-specific databases

CTD256949.
GeneCardsGC19M008387.
HGNCHGNC:24796. KANK3.
HPAHPA051153.
MIM614611. gene.
neXtProtNX_Q6NY19.
PharmGKBPA162392612.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG0666.
HOGENOMHOG000060328.
HOVERGENHBG101217.
InParanoidQ6NY19.
OMAEHQRGVS.
OrthoDBEOG7NW687.
PhylomeDBQ6NY19.
TreeFamTF324499.

Gene expression databases

ArrayExpressQ6NY19.
BgeeQ6NY19.
CleanExHS_KANK3.
GenevestigatorQ6NY19.

Family and domain databases

Gene3D1.25.40.20. 1 hit.
InterProIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR029484. GVQW.
IPR021939. KN_motif.
[Graphical view]
PfamPF12796. Ank_2. 2 hits.
PF13900. GVQW. 1 hit.
PF12075. KN_motif. 1 hit.
[Graphical view]
PRINTSPR01415. ANKYRIN.
SMARTSM00248. ANK. 4 hits.
[Graphical view]
SUPFAMSSF48403. SSF48403. 1 hit.
PROSITEPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 2 hits.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi256949.
NextBio92881.
PROQ6NY19.
SOURCESearch...

Entry information

Entry nameKANK3_HUMAN
AccessionPrimary (citable) accession number: Q6NY19
Secondary accession number(s): Q6NZI1, Q6ZQR3, Q8IUV2
Entry history
Integrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: July 5, 2004
Last modified: July 9, 2014
This is version 95 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 19

Human chromosome 19: entries, gene names and cross-references to MIM