Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6NY19

- KANK3_HUMAN

UniProt

Q6NY19 - KANK3_HUMAN

Protein

KN motif and ankyrin repeat domain-containing protein 3

Gene

KANK3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 96 (01 Oct 2014)
      Sequence version 1 (05 Jul 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May be involved in the control of cytoskeleton formation by regulating actin polymerization.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    KN motif and ankyrin repeat domain-containing protein 3
    Alternative name(s):
    Ankyrin repeat domain-containing protein 47
    Gene namesi
    Name:KANK3
    Synonyms:ANKRD47
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 19

    Organism-specific databases

    HGNCiHGNC:24796. KANK3.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA162392612.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 840840KN motif and ankyrin repeat domain-containing protein 3PRO_0000244582Add
    BLAST

    Proteomic databases

    PaxDbiQ6NY19.
    PRIDEiQ6NY19.

    PTM databases

    PhosphoSiteiQ6NY19.

    Expressioni

    Tissue specificityi

    Strongly expressed in breast, liver, lung, skeletal muscle and kidney.1 Publication

    Gene expression databases

    ArrayExpressiQ6NY19.
    BgeeiQ6NY19.
    CleanExiHS_KANK3.
    GenevestigatoriQ6NY19.

    Organism-specific databases

    HPAiHPA051153.

    Interactioni

    Protein-protein interaction databases

    BioGridi129185. 1 interaction.
    IntActiQ6NY19. 1 interaction.

    Structurei

    3D structure databases

    ProteinModelPortaliQ6NY19.
    SMRiQ6NY19. Positions 547-787.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati622 – 65231ANK 1Add
    BLAST
    Repeati656 – 69035ANK 2Add
    BLAST
    Repeati695 – 72430ANK 3Add
    BLAST
    Repeati728 – 75831ANK 4Add
    BLAST
    Repeati762 – 79534ANK 5Add
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili181 – 23050Sequence AnalysisAdd
    BLAST
    Coiled coili367 – 40438Sequence AnalysisAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi479 – 4824Poly-Ser
    Compositional biasi807 – 8104Poly-Pro

    Sequence similaritiesi

    Contains 5 ANK repeats.PROSITE-ProRule annotation

    Keywords - Domaini

    ANK repeat, Coiled coil, Repeat

    Phylogenomic databases

    eggNOGiCOG0666.
    HOGENOMiHOG000060328.
    HOVERGENiHBG101217.
    InParanoidiQ6NY19.
    OMAiEHQRGVS.
    OrthoDBiEOG7NW687.
    PhylomeDBiQ6NY19.
    TreeFamiTF324499.

    Family and domain databases

    Gene3Di1.25.40.20. 1 hit.
    InterProiIPR002110. Ankyrin_rpt.
    IPR020683. Ankyrin_rpt-contain_dom.
    IPR029484. GVQW.
    IPR021939. KN_motif.
    [Graphical view]
    PfamiPF12796. Ank_2. 2 hits.
    PF13900. GVQW. 1 hit.
    PF12075. KN_motif. 1 hit.
    [Graphical view]
    PRINTSiPR01415. ANKYRIN.
    SMARTiSM00248. ANK. 4 hits.
    [Graphical view]
    SUPFAMiSSF48403. SSF48403. 1 hit.
    PROSITEiPS50297. ANK_REP_REGION. 1 hit.
    PS50088. ANK_REPEAT. 2 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6NY19-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAKFALNQNL PDLGGPRLCP VPAAGGARSP SSPYSVETPY GFHLDLDFLK    50
    YIEELERGPA ARRAPGPPTS RRPRAPRPGL AGARSPGAWT SSESLASDDG 100
    GAPGILSQGA PSGLLMQPLS PRAPVRNPRV EHTLRETSRR LELAQTHERA 150
    PSPGRGVPRS PRGSGRSSPA PNLAPASPGP AQLQLVREQM AAALRRLREL 200
    EDQARTLPEL QEQVRALRAE KARLLAGRAQ PEPDGEAETR PDKLAQLRRL 250
    TERLATSERG GRARASPRAD SPDGLAAGRS EGALQVLDGE VGSLDGTPQT 300
    REVAAEAVPE TREAGAQAVP ETREAGVEAA PETVEADAWV TEALLGLPAA 350
    AERELELLRA SLEHQRGVSE LLRGRLRELE EAREAAEEAA AGARAQLREA 400
    TTQTPWSCAE KAAQTESPAE APSLTQESSP GSMDGDRAVA PAGILKSIMK 450
    KRDGTPGAQP SSGPKSLQFV GVLNGEYESS SSEDASDSDG DSENGGAEPP 500
    GSSSGSGDDS GGGSDSGTPG PPSGGDIRDP EPEAEAEPQQ VAQGRCELSP 550
    RLREACVALQ RQLSRPRGVA SDGGAVRLVA QEWFRVSSQR RSQAEPVARM 600
    LEGVRRLGPE LLAHVVNLAD GNGNTALHYS VSHGNLAIAS LLLDTGACEV 650
    NRQNRAGYSA LMLAALTSVR QEEEDMAVVQ RLFCMGDVNA KASQTGQTAL 700
    MLAISHGRQD MVATLLACGA DVNAQDADGA TALMCASEYG RLDTVRLLLT 750
    QPGCDPAILD NEGTSALAIA LEAEQDEVAA LLHAHLSSGQ PDTQAGVQRH 800
    NLSSLQPPPP RFKKFSCLSL PSSWDYNSCE PSRLAQLTIF 840
    Length:840
    Mass (Da):88,425
    Last modified:July 5, 2004 - v1
    Checksum:i4F917006B1B0FB66
    GO
    Isoform 2 (identifier: Q6NY19-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         795-840: AGVQRHNLSSLQPPPPRFKKFSCLSLPSSWDYNSCEPSRLAQLTIF → SESPPGSQTATPGEGECGDNGENPQVQ

    Show »
    Length:821
    Mass (Da):85,893
    Checksum:i66CCB7F5B1B251F5
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti288 – 2881D → Y.1 Publication
    Corresponds to variant rs890850 [ dbSNP | Ensembl ].
    VAR_026909
    Natural varianti359 – 3591R → H.
    Corresponds to variant rs890853 [ dbSNP | Ensembl ].
    VAR_026910
    Natural varianti485 – 4851A → T.1 Publication
    Corresponds to variant rs2913955 [ dbSNP | Ensembl ].
    VAR_026911

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei795 – 84046AGVQR…QLTIF → SESPPGSQTATPGEGECGDN GENPQVQ in isoform 2. 2 PublicationsVSP_019607Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK128815 mRNA. Translation: BAC87620.1.
    BC035849 mRNA. Translation: AAH35849.1.
    BC066124 mRNA. Translation: AAH66124.1.
    BC066775 mRNA. Translation: AAH66775.1.
    CCDSiCCDS12199.1. [Q6NY19-2]
    RefSeqiNP_940873.2. NM_198471.2. [Q6NY19-2]
    XP_006722781.1. XM_006722718.1. [Q6NY19-2]
    UniGeneiHs.745036.

    Genome annotation databases

    GeneIDi256949.
    KEGGihsa:256949.
    UCSCiuc010dwa.3. human. [Q6NY19-2]

    Polymorphism databases

    DMDMi74749039.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK128815 mRNA. Translation: BAC87620.1 .
    BC035849 mRNA. Translation: AAH35849.1 .
    BC066124 mRNA. Translation: AAH66124.1 .
    BC066775 mRNA. Translation: AAH66775.1 .
    CCDSi CCDS12199.1. [Q6NY19-2 ]
    RefSeqi NP_940873.2. NM_198471.2. [Q6NY19-2 ]
    XP_006722781.1. XM_006722718.1. [Q6NY19-2 ]
    UniGenei Hs.745036.

    3D structure databases

    ProteinModelPortali Q6NY19.
    SMRi Q6NY19. Positions 547-787.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 129185. 1 interaction.
    IntActi Q6NY19. 1 interaction.

    PTM databases

    PhosphoSitei Q6NY19.

    Polymorphism databases

    DMDMi 74749039.

    Proteomic databases

    PaxDbi Q6NY19.
    PRIDEi Q6NY19.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 256949.
    KEGGi hsa:256949.
    UCSCi uc010dwa.3. human. [Q6NY19-2 ]

    Organism-specific databases

    CTDi 256949.
    GeneCardsi GC19M008387.
    HGNCi HGNC:24796. KANK3.
    HPAi HPA051153.
    MIMi 614611. gene.
    neXtProti NX_Q6NY19.
    PharmGKBi PA162392612.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0666.
    HOGENOMi HOG000060328.
    HOVERGENi HBG101217.
    InParanoidi Q6NY19.
    OMAi EHQRGVS.
    OrthoDBi EOG7NW687.
    PhylomeDBi Q6NY19.
    TreeFami TF324499.

    Miscellaneous databases

    GenomeRNAii 256949.
    NextBioi 92881.
    PROi Q6NY19.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q6NY19.
    Bgeei Q6NY19.
    CleanExi HS_KANK3.
    Genevestigatori Q6NY19.

    Family and domain databases

    Gene3Di 1.25.40.20. 1 hit.
    InterProi IPR002110. Ankyrin_rpt.
    IPR020683. Ankyrin_rpt-contain_dom.
    IPR029484. GVQW.
    IPR021939. KN_motif.
    [Graphical view ]
    Pfami PF12796. Ank_2. 2 hits.
    PF13900. GVQW. 1 hit.
    PF12075. KN_motif. 1 hit.
    [Graphical view ]
    PRINTSi PR01415. ANKYRIN.
    SMARTi SM00248. ANK. 4 hits.
    [Graphical view ]
    SUPFAMi SSF48403. SSF48403. 1 hit.
    PROSITEi PS50297. ANK_REP_REGION. 1 hit.
    PS50088. ANK_REPEAT. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS TYR-288 AND THR-485.
      Tissue: Mammary gland.
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Brain and Placenta.
    3. "Kank proteins: a new family of ankyrin-repeat domain-containing proteins."
      Zhu Y., Kakinuma N., Wang Y., Kiyama R.
      Biochim. Biophys. Acta 1780:128-133(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: POSSIBLE FUNCTION, TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiKANK3_HUMAN
    AccessioniPrimary (citable) accession number: Q6NY19
    Secondary accession number(s): Q6NZI1, Q6ZQR3, Q8IUV2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 27, 2006
    Last sequence update: July 5, 2004
    Last modified: October 1, 2014
    This is version 96 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 19
      Human chromosome 19: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3