Q6NY19 (KANK3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 84.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: KN motif and ankyrin repeat domain-containing protein 3 Alternative name(s): Ankyrin repeat domain-containing protein 47 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 840 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | May be involved in the control of cytoskeleton formation by regulating actin polymerization. Ref.3 |
| Tissue specificity | Strongly expressed in breast, liver, lung, skeletal muscle and kidney. Ref.3 |
| Sequence similarities | Contains 5 ANK repeats. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | ANK repeat Coiled coil Repeat |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6NY19-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6NY19-2) The sequence of this isoform differs from the canonical sequence as follows: 795-840: AGVQRHNLSSLQPPPPRFKKFSCLSLPSSWDYNSCEPSRLAQLTIF → SESPPGSQTATPGEGECGDNGENPQVQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 840 | 840 | KN motif and ankyrin repeat domain-containing protein 3 | PRO_0000244582 | |||||
Regions | |||||||||
| Repeat | 622 – 652 | 31 | ANK 1 | ||||||
| Repeat | 656 – 690 | 35 | ANK 2 | ||||||
| Repeat | 695 – 724 | 30 | ANK 3 | ||||||
| Repeat | 728 – 758 | 31 | ANK 4 | ||||||
| Repeat | 762 – 795 | 34 | ANK 5 | ||||||
| Coiled coil | 181 – 230 | 50 | Potential | ||||||
| Coiled coil | 367 – 404 | 38 | Potential | ||||||
| Compositional bias | 479 – 482 | 4 | Poly-Ser | ||||||
| Compositional bias | 807 – 810 | 4 | Poly-Pro | ||||||
Natural variations | |||||||||
| Alternative sequence | 795 – 840 | 46 | AGVQR…QLTIF → SESPPGSQTATPGEGECGDN GENPQVQ in isoform 2. | VSP_019607 | |||||
| Natural variant | 288 | 1 | D → Y. Ref.1 Corresponds to variant rs890850 [ dbSNP | Ensembl ]. | VAR_026909 | |||||
| Natural variant | 359 | 1 | R → H. Corresponds to variant rs890853 [ dbSNP | Ensembl ]. | VAR_026910 | |||||
| Natural variant | 485 | 1 | A → T. Ref.1 Corresponds to variant rs2913955 [ dbSNP | Ensembl ]. | VAR_026911 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS TYR-288 AND THR-485. Tissue: Mammary gland. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Brain and Placenta. |
| [3] | "Kank proteins: a new family of ankyrin-repeat domain-containing proteins." Zhu Y., Kakinuma N., Wang Y., Kiyama R. Biochim. Biophys. Acta 1780:128-133(2008) [PubMed] [Europe PMC] [Abstract] Cited for: POSSIBLE FUNCTION, TISSUE SPECIFICITY. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK128815 mRNA. Translation: BAC87620.1. BC035849 mRNA. Translation: AAH35849.1. BC066124 mRNA. Translation: AAH66124.1. BC066775 mRNA. Translation: AAH66775.1. |
| IPI | IPI00394818. IPI00744564. |
| RefSeq | NP_940873.2. NM_198471.2. |
| UniGene | Hs.322473. |
3D structure databases | |
| ProteinModelPortal | Q6NY19. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q6NY19. 1 interaction. |
PTM databases | |
| PhosphoSite | Q6NY19. |
Polymorphism databases | |
| DMDM | 74749039. |
Proteomic databases | |
| PaxDb | Q6NY19. |
| PRIDE | Q6NY19. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000330915; ENSP00000328923; ENSG00000186994. ENST00000593649; ENSP00000470728; ENSG00000186994. |
| GeneID | 256949. |
| KEGG | hsa:256949. |
| UCSC | uc010dwa.3. human. |
Organism-specific databases | |
| CTD | 256949. |
| GeneCards | GC19M008387. |
| HGNC | HGNC:24796. KANK3. |
| HPA | HPA051153. |
| MIM | 614611. gene. |
| neXtProt | NX_Q6NY19. |
| PharmGKB | PA162392612. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0666. |
| HOGENOM | HOG000060328. |
| HOVERGEN | HBG101217. |
| InParanoid | Q6NY19. |
| OMA | NPRVEHT. |
Gene expression databases | |
| Bgee | Q6NY19. |
| CleanEx | HS_KANK3. |
| Genevestigator | Q6NY19. |
| GermOnline | ENSG00000186994. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.25.40.20. 1 hit. |
| InterPro | IPR002110. Ankyrin_rpt. IPR020683. Ankyrin_rpt-contain_dom. IPR021939. KN_motif. [Graphical view] |
| Pfam | PF12796. Ank_2. 2 hits. PF12075. KN_motif. 1 hit. [Graphical view] |
| PRINTS | PR01415. ANKYRIN. |
| SMART | SM00248. ANK. 4 hits. [Graphical view] |
| SUPFAM | SSF48403. ANK. 1 hit. |
| PROSITE | PS50297. ANK_REP_REGION. 1 hit. PS50088. ANK_REPEAT. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 256949. |
| NextBio | 92881. |
| SOURCE | Search... |
Entry information
| Entry name | KANK3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6NY19 Secondary accession number(s): Q6NZI1, Q6ZQR3, Q8IUV2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
