SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6NXT4

- ZNT6_HUMAN

UniProt

Q6NXT4 - ZNT6_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Zinc transporter 6
Gene
SLC30A6, ZNT6
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Functioni

Zinc-efflux transporter which allocates the cytoplasmic zinc to the trans-Golgi network (TGN) as well as the vesicular compartment By similarity.

GO - Molecular functioni

  1. zinc ion transmembrane transporter activity Source: Ensembl

GO - Biological processi

  1. Golgi to endosome transport Source: Ensembl
  2. cellular protein metabolic process Source: Reactome
  3. transmembrane transport Source: Reactome
Complete GO annotation...

Keywords - Biological processi

Ion transport, Transport, Zinc transport

Keywords - Ligandi

Zinc

Enzyme and pathway databases

ReactomeiREACT_15550. Insulin processing.
REACT_20582. Zinc efflux and compartmentalization by the SLC30 family.

Protein family/group databases

TCDBi2.A.4.4.4. the cation diffusion facilitator (cdf) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc transporter 6
Short name:
ZnT-6
Alternative name(s):
Solute carrier family 30 member 6
Gene namesi
Name:SLC30A6
Synonyms:ZNT6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:19305. SLC30A6.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 3333Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei34 – 5421Helical; Reviewed prediction
Add
BLAST
Topological domaini55 – 6410Extracellular Reviewed prediction
Transmembranei65 – 8521Helical; Reviewed prediction
Add
BLAST
Topological domaini86 – 9813Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei99 – 11921Helical; Reviewed prediction
Add
BLAST
Topological domaini120 – 13415Extracellular Reviewed prediction
Add
BLAST
Transmembranei135 – 15521Helical; Reviewed prediction
Add
BLAST
Topological domaini156 – 20045Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei201 – 22121Helical; Reviewed prediction
Add
BLAST
Topological domaini222 – 2232Extracellular Reviewed prediction
Transmembranei224 – 24421Helical; Reviewed prediction
Add
BLAST
Topological domaini245 – 461217Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. Golgi apparatus Source: BHF-UCL
  2. Golgi membrane Source: Reactome
  3. integral component of membrane Source: UniProtKB-KW
  4. mitochondrion Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134923067.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 461461Zinc transporter 6
PRO_0000312573Add
BLAST

Proteomic databases

MaxQBiQ6NXT4.
PaxDbiQ6NXT4.
PRIDEiQ6NXT4.

PTM databases

PhosphoSiteiQ6NXT4.

Expressioni

Tissue specificityi

Expressed in brain; especially in cerebellum, hippocampus, parahippocampal gyrus, superior and middle temporal gyrus. Also expressed in B-cells, colon, eye, and lung. Lower expression was present in bone, brain, cervix, ear, heart, kidney, muscle, nerve, pancreas, prostate, skin, stomach, and testis.2 Publications

Gene expression databases

ArrayExpressiQ6NXT4.
BgeeiQ6NXT4.
CleanExiHS_SLC30A6.
GenevestigatoriQ6NXT4.

Organism-specific databases

HPAiHPA055032.
HPA057328.

Interactioni

Subunit structurei

Heterooligomer. Interacts with ZNT5 By similarity.

Protein-protein interaction databases

BioGridi120806. 1 interaction.
IntActiQ6NXT4. 1 interaction.
STRINGi9606.ENSP00000282587.

Structurei

3D structure databases

ProteinModelPortaliQ6NXT4.

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG1230.
HOGENOMiHOG000060341.
HOVERGENiHBG106400.
KOiK14693.
OMAiPSRYGTN.
PhylomeDBiQ6NXT4.
TreeFamiTF313167.

Family and domain databases

Gene3Di1.20.1510.10. 1 hit.
InterProiIPR002524. Cation_efflux.
IPR027469. Cation_efflux_TMD.
[Graphical view]
PANTHERiPTHR11562. PTHR11562. 1 hit.
PfamiPF01545. Cation_efflux. 1 hit.
[Graphical view]
TIGRFAMsiTIGR01297. CDF. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6NXT4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGTIHLFRKP QRSFFGKLLR EFRLVAADRR SWKILLFGVI NLICTGFLLM    50
WCSSTNSIAL TAYTYLTIFD LFSLMTCLIS YWVTLRKPSP VYSFGFERLE 100
VLAVFASTVL AQLGALFILK ESAERFLEQP EIHTGRLLVG TFVALCFNLF 150
TMLSIRNKPF AYVSEAASTS WLQEHVADLS RSLCGIIPGL SSIFLPRMNP 200
FVLIDLAGAF ALCITYMLIE INNYFAVDTA SAIAIALMTF GTMYPMSVYS 250
GKVLLQTTPP HVIGQLDKLI REVSTLDGVL EVRNEHFWTL GFGSLAGSVH 300
VRIRRDANEQ MVLAHVTNRL YTLVSTLTVQ IFKDDWIRPA LLSGPVAANV 350
LNFSDHHVIP MPLLKGTDDL NPVTSTPAKP SSPPPEFSFN TPGKNVNPVI 400
LLNTQTRPYG FGLNHGHTPY SSMLNQGLGV PGIGATQGLR TGFTNIPSRY 450
GTNNRIGQPR P 461
Length:461
Mass (Da):51,116
Last modified:December 4, 2007 - v2
Checksum:i7926F6888EF1F1F9
GO
Isoform 2 (identifier: Q6NXT4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     72-72: F → FRDGVSPFWLGWSQTPDLKWSTHLGLPKCWDNRRELPCLSN

Note: No experimental confirmation available.

Show »
Length:501
Mass (Da):55,795
Checksum:iB685D2C0FADA5105
GO
Isoform 4 (identifier: Q6NXT4-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MGTIHLFRKPQRSFFGKLLREFRLVAADRR → M

Note: No experimental confirmation available.

Show »
Length:432
Mass (Da):47,617
Checksum:iEBC38BF0D245D824
GO
Isoform 3 (identifier: Q6NXT4-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     273-295: Missing.

Note: No experimental confirmation available.

Show »
Length:438
Mass (Da):48,557
Checksum:iAD591DAF786B8385
GO

Sequence cautioni

The sequence AAH32525.1 differs from that shown. Reason: Erroneous initiation.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3030MGTIH…AADRR → M in isoform 4.
VSP_045198Add
BLAST
Alternative sequencei72 – 721F → FRDGVSPFWLGWSQTPDLKW STHLGLPKCWDNRRELPCLS N in isoform 2.
VSP_029861
Alternative sequencei273 – 29523Missing in isoform 3.
VSP_029862Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti198 – 1992MN → TR in AAH32525. 1 Publication
Sequence conflicti454 – 4541N → S in AAH66903. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK055663 mRNA. Translation: BAB70980.1.
AK304225 mRNA. Translation: BAH14137.1.
EF560719 mRNA. Translation: ABQ59029.1.
EF560726 mRNA. Translation: ABQ59036.1.
AL121653 Genomic DNA. No translation available.
AL121658 Genomic DNA. No translation available.
CH471053 Genomic DNA. Translation: EAX00456.1.
BC032525 mRNA. Translation: AAH32525.1. Different initiation.
BC066903 mRNA. Translation: AAH66903.1.
CCDSiCCDS1780.1. [Q6NXT4-1]
CCDS54341.1. [Q6NXT4-2]
CCDS54342.1. [Q6NXT4-3]
CCDS54343.1. [Q6NXT4-4]
RefSeqiNP_001180442.1. NM_001193513.1. [Q6NXT4-2]
NP_001180443.1. NM_001193514.1. [Q6NXT4-3]
NP_001180444.1. NM_001193515.1. [Q6NXT4-4]
NP_060434.2. NM_017964.3. [Q6NXT4-1]
UniGeneiHs.23248.

Genome annotation databases

EnsembliENST00000282587; ENSP00000282587; ENSG00000152683. [Q6NXT4-1]
ENST00000379343; ENSP00000368648; ENSG00000152683. [Q6NXT4-2]
ENST00000435660; ENSP00000399005; ENSG00000152683. [Q6NXT4-3]
ENST00000538303; ENSP00000440678; ENSG00000152683. [Q6NXT4-4]
GeneIDi55676.
KEGGihsa:55676.
UCSCiuc002roe.2. human. [Q6NXT4-1]
uc002rof.2. human. [Q6NXT4-2]
uc010ezr.2. human. [Q6NXT4-3]
uc010ymw.2. human.

Polymorphism databases

DMDMi162416263.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK055663 mRNA. Translation: BAB70980.1 .
AK304225 mRNA. Translation: BAH14137.1 .
EF560719 mRNA. Translation: ABQ59029.1 .
EF560726 mRNA. Translation: ABQ59036.1 .
AL121653 Genomic DNA. No translation available.
AL121658 Genomic DNA. No translation available.
CH471053 Genomic DNA. Translation: EAX00456.1 .
BC032525 mRNA. Translation: AAH32525.1 . Different initiation.
BC066903 mRNA. Translation: AAH66903.1 .
CCDSi CCDS1780.1. [Q6NXT4-1 ]
CCDS54341.1. [Q6NXT4-2 ]
CCDS54342.1. [Q6NXT4-3 ]
CCDS54343.1. [Q6NXT4-4 ]
RefSeqi NP_001180442.1. NM_001193513.1. [Q6NXT4-2 ]
NP_001180443.1. NM_001193514.1. [Q6NXT4-3 ]
NP_001180444.1. NM_001193515.1. [Q6NXT4-4 ]
NP_060434.2. NM_017964.3. [Q6NXT4-1 ]
UniGenei Hs.23248.

3D structure databases

ProteinModelPortali Q6NXT4.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120806. 1 interaction.
IntActi Q6NXT4. 1 interaction.
STRINGi 9606.ENSP00000282587.

Protein family/group databases

TCDBi 2.A.4.4.4. the cation diffusion facilitator (cdf) family.

PTM databases

PhosphoSitei Q6NXT4.

Polymorphism databases

DMDMi 162416263.

Proteomic databases

MaxQBi Q6NXT4.
PaxDbi Q6NXT4.
PRIDEi Q6NXT4.

Protocols and materials databases

DNASUi 55676.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000282587 ; ENSP00000282587 ; ENSG00000152683 . [Q6NXT4-1 ]
ENST00000379343 ; ENSP00000368648 ; ENSG00000152683 . [Q6NXT4-2 ]
ENST00000435660 ; ENSP00000399005 ; ENSG00000152683 . [Q6NXT4-3 ]
ENST00000538303 ; ENSP00000440678 ; ENSG00000152683 . [Q6NXT4-4 ]
GeneIDi 55676.
KEGGi hsa:55676.
UCSCi uc002roe.2. human. [Q6NXT4-1 ]
uc002rof.2. human. [Q6NXT4-2 ]
uc010ezr.2. human. [Q6NXT4-3 ]
uc010ymw.2. human.

Organism-specific databases

CTDi 55676.
GeneCardsi GC02P032390.
H-InvDB HIX0001954.
HGNCi HGNC:19305. SLC30A6.
HPAi HPA055032.
HPA057328.
MIMi 611148. gene.
neXtProti NX_Q6NXT4.
PharmGKBi PA134923067.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG1230.
HOGENOMi HOG000060341.
HOVERGENi HBG106400.
KOi K14693.
OMAi PSRYGTN.
PhylomeDBi Q6NXT4.
TreeFami TF313167.

Enzyme and pathway databases

Reactomei REACT_15550. Insulin processing.
REACT_20582. Zinc efflux and compartmentalization by the SLC30 family.

Miscellaneous databases

ChiTaRSi SLC30A6. human.
GenomeRNAii 55676.
NextBioi 60456.
PROi Q6NXT4.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q6NXT4.
Bgeei Q6NXT4.
CleanExi HS_SLC30A6.
Genevestigatori Q6NXT4.

Family and domain databases

Gene3Di 1.20.1510.10. 1 hit.
InterProi IPR002524. Cation_efflux.
IPR027469. Cation_efflux_TMD.
[Graphical view ]
PANTHERi PTHR11562. PTHR11562. 1 hit.
Pfami PF01545. Cation_efflux. 1 hit.
[Graphical view ]
TIGRFAMsi TIGR01297. CDF. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4).
    Tissue: Trachea.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: Seminoma and Uterus.
  3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain and Eye.
  6. "In silico identification and expression of SLC30 family genes: an expressed sequence tag data mining strategy for the characterization of zinc transporters' tissue expression."
    Seve M., Chimienti F., Devergnas S., Favier A.
    BMC Genomics 5:32-32(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  7. "Altered expression of zinc transporters-4 and -6 in mild cognitive impairment, early and late Alzheimer's disease brain."
    Smith J.L., Xiong S., Markesbery W.R., Lovell M.A.
    Neuroscience 140:879-888(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  8. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiZNT6_HUMAN
AccessioniPrimary (citable) accession number: Q6NXT4
Secondary accession number(s): A5YM45
, B7Z901, Q8N5C9, Q96NC3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: December 4, 2007
Last modified: September 3, 2014
This is version 88 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Seems to have lost most of the histidine residues in the loop between the fourth and fifth transmembrane regions and appears to exert transport function by forming complexes with ZNT5 By similarity.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi