Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6NXT4

- ZNT6_HUMAN

UniProt

Q6NXT4 - ZNT6_HUMAN

Protein

Zinc transporter 6

Gene

SLC30A6

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 89 (01 Oct 2014)
      Sequence version 2 (04 Dec 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Zinc-efflux transporter which allocates the cytoplasmic zinc to the trans-Golgi network (TGN) as well as the vesicular compartment.By similarity

    GO - Molecular functioni

    1. zinc ion transmembrane transporter activity Source: Ensembl

    GO - Biological processi

    1. cellular protein metabolic process Source: Reactome
    2. Golgi to endosome transport Source: Ensembl
    3. transmembrane transport Source: Reactome

    Keywords - Biological processi

    Ion transport, Transport, Zinc transport

    Keywords - Ligandi

    Zinc

    Enzyme and pathway databases

    ReactomeiREACT_15550. Insulin processing.
    REACT_20582. Zinc efflux and compartmentalization by the SLC30 family.

    Protein family/group databases

    TCDBi2.A.4.4.4. the cation diffusion facilitator (cdf) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Zinc transporter 6
    Short name:
    ZnT-6
    Alternative name(s):
    Solute carrier family 30 member 6
    Gene namesi
    Name:SLC30A6
    Synonyms:ZNT6
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:19305. SLC30A6.

    Subcellular locationi

    GO - Cellular componenti

    1. Golgi apparatus Source: BHF-UCL
    2. Golgi membrane Source: Reactome
    3. integral component of membrane Source: UniProtKB-KW
    4. mitochondrion Source: Ensembl

    Keywords - Cellular componenti

    Golgi apparatus, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134923067.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 461461Zinc transporter 6PRO_0000312573Add
    BLAST

    Proteomic databases

    MaxQBiQ6NXT4.
    PaxDbiQ6NXT4.
    PRIDEiQ6NXT4.

    PTM databases

    PhosphoSiteiQ6NXT4.

    Expressioni

    Tissue specificityi

    Expressed in brain; especially in cerebellum, hippocampus, parahippocampal gyrus, superior and middle temporal gyrus. Also expressed in B-cells, colon, eye, and lung. Lower expression was present in bone, brain, cervix, ear, heart, kidney, muscle, nerve, pancreas, prostate, skin, stomach, and testis.2 Publications

    Gene expression databases

    ArrayExpressiQ6NXT4.
    BgeeiQ6NXT4.
    CleanExiHS_SLC30A6.
    GenevestigatoriQ6NXT4.

    Organism-specific databases

    HPAiHPA055032.
    HPA057328.

    Interactioni

    Subunit structurei

    Heterooligomer. Interacts with ZNT5 By similarity.By similarity

    Protein-protein interaction databases

    BioGridi120806. 1 interaction.
    IntActiQ6NXT4. 1 interaction.
    STRINGi9606.ENSP00000282587.

    Structurei

    3D structure databases

    ProteinModelPortaliQ6NXT4.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 3333CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini55 – 6410ExtracellularSequence Analysis
    Topological domaini86 – 9813CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini120 – 13415ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini156 – 20045CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini222 – 2232ExtracellularSequence Analysis
    Topological domaini245 – 461217CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei34 – 5421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei65 – 8521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei99 – 11921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei135 – 15521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei201 – 22121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei224 – 24421HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG1230.
    HOGENOMiHOG000060341.
    HOVERGENiHBG106400.
    KOiK14693.
    OMAiPSRYGTN.
    PhylomeDBiQ6NXT4.
    TreeFamiTF313167.

    Family and domain databases

    Gene3Di1.20.1510.10. 1 hit.
    InterProiIPR002524. Cation_efflux.
    IPR027469. Cation_efflux_TMD.
    [Graphical view]
    PANTHERiPTHR11562. PTHR11562. 1 hit.
    PfamiPF01545. Cation_efflux. 1 hit.
    [Graphical view]
    TIGRFAMsiTIGR01297. CDF. 1 hit.

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6NXT4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGTIHLFRKP QRSFFGKLLR EFRLVAADRR SWKILLFGVI NLICTGFLLM    50
    WCSSTNSIAL TAYTYLTIFD LFSLMTCLIS YWVTLRKPSP VYSFGFERLE 100
    VLAVFASTVL AQLGALFILK ESAERFLEQP EIHTGRLLVG TFVALCFNLF 150
    TMLSIRNKPF AYVSEAASTS WLQEHVADLS RSLCGIIPGL SSIFLPRMNP 200
    FVLIDLAGAF ALCITYMLIE INNYFAVDTA SAIAIALMTF GTMYPMSVYS 250
    GKVLLQTTPP HVIGQLDKLI REVSTLDGVL EVRNEHFWTL GFGSLAGSVH 300
    VRIRRDANEQ MVLAHVTNRL YTLVSTLTVQ IFKDDWIRPA LLSGPVAANV 350
    LNFSDHHVIP MPLLKGTDDL NPVTSTPAKP SSPPPEFSFN TPGKNVNPVI 400
    LLNTQTRPYG FGLNHGHTPY SSMLNQGLGV PGIGATQGLR TGFTNIPSRY 450
    GTNNRIGQPR P 461
    Length:461
    Mass (Da):51,116
    Last modified:December 4, 2007 - v2
    Checksum:i7926F6888EF1F1F9
    GO
    Isoform 2 (identifier: Q6NXT4-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         72-72: F → FRDGVSPFWLGWSQTPDLKWSTHLGLPKCWDNRRELPCLSN

    Note: No experimental confirmation available.

    Show »
    Length:501
    Mass (Da):55,795
    Checksum:iB685D2C0FADA5105
    GO
    Isoform 4 (identifier: Q6NXT4-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-30: MGTIHLFRKPQRSFFGKLLREFRLVAADRR → M

    Note: No experimental confirmation available.

    Show »
    Length:432
    Mass (Da):47,617
    Checksum:iEBC38BF0D245D824
    GO
    Isoform 3 (identifier: Q6NXT4-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         273-295: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:438
    Mass (Da):48,557
    Checksum:iAD591DAF786B8385
    GO

    Sequence cautioni

    The sequence AAH32525.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti198 – 1992MN → TR in AAH32525. (PubMed:15489334)Curated
    Sequence conflicti454 – 4541N → S in AAH66903. (PubMed:15489334)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3030MGTIH…AADRR → M in isoform 4. 1 PublicationVSP_045198Add
    BLAST
    Alternative sequencei72 – 721F → FRDGVSPFWLGWSQTPDLKW STHLGLPKCWDNRRELPCLS N in isoform 2. 1 PublicationVSP_029861
    Alternative sequencei273 – 29523Missing in isoform 3. 1 PublicationVSP_029862Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK055663 mRNA. Translation: BAB70980.1.
    AK304225 mRNA. Translation: BAH14137.1.
    EF560719 mRNA. Translation: ABQ59029.1.
    EF560726 mRNA. Translation: ABQ59036.1.
    AL121653 Genomic DNA. No translation available.
    AL121658 Genomic DNA. No translation available.
    CH471053 Genomic DNA. Translation: EAX00456.1.
    BC032525 mRNA. Translation: AAH32525.1. Different initiation.
    BC066903 mRNA. Translation: AAH66903.1.
    CCDSiCCDS1780.1. [Q6NXT4-1]
    CCDS54341.1. [Q6NXT4-2]
    CCDS54342.1. [Q6NXT4-3]
    CCDS54343.1. [Q6NXT4-4]
    RefSeqiNP_001180442.1. NM_001193513.1. [Q6NXT4-2]
    NP_001180443.1. NM_001193514.1. [Q6NXT4-3]
    NP_001180444.1. NM_001193515.1. [Q6NXT4-4]
    NP_060434.2. NM_017964.3. [Q6NXT4-1]
    UniGeneiHs.23248.

    Genome annotation databases

    EnsembliENST00000282587; ENSP00000282587; ENSG00000152683. [Q6NXT4-1]
    ENST00000379343; ENSP00000368648; ENSG00000152683. [Q6NXT4-2]
    ENST00000435660; ENSP00000399005; ENSG00000152683. [Q6NXT4-3]
    GeneIDi55676.
    KEGGihsa:55676.
    UCSCiuc002roe.2. human. [Q6NXT4-1]
    uc002rof.2. human. [Q6NXT4-2]
    uc010ezr.2. human. [Q6NXT4-3]
    uc010ymw.2. human.

    Polymorphism databases

    DMDMi162416263.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK055663 mRNA. Translation: BAB70980.1 .
    AK304225 mRNA. Translation: BAH14137.1 .
    EF560719 mRNA. Translation: ABQ59029.1 .
    EF560726 mRNA. Translation: ABQ59036.1 .
    AL121653 Genomic DNA. No translation available.
    AL121658 Genomic DNA. No translation available.
    CH471053 Genomic DNA. Translation: EAX00456.1 .
    BC032525 mRNA. Translation: AAH32525.1 . Different initiation.
    BC066903 mRNA. Translation: AAH66903.1 .
    CCDSi CCDS1780.1. [Q6NXT4-1 ]
    CCDS54341.1. [Q6NXT4-2 ]
    CCDS54342.1. [Q6NXT4-3 ]
    CCDS54343.1. [Q6NXT4-4 ]
    RefSeqi NP_001180442.1. NM_001193513.1. [Q6NXT4-2 ]
    NP_001180443.1. NM_001193514.1. [Q6NXT4-3 ]
    NP_001180444.1. NM_001193515.1. [Q6NXT4-4 ]
    NP_060434.2. NM_017964.3. [Q6NXT4-1 ]
    UniGenei Hs.23248.

    3D structure databases

    ProteinModelPortali Q6NXT4.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120806. 1 interaction.
    IntActi Q6NXT4. 1 interaction.
    STRINGi 9606.ENSP00000282587.

    Protein family/group databases

    TCDBi 2.A.4.4.4. the cation diffusion facilitator (cdf) family.

    PTM databases

    PhosphoSitei Q6NXT4.

    Polymorphism databases

    DMDMi 162416263.

    Proteomic databases

    MaxQBi Q6NXT4.
    PaxDbi Q6NXT4.
    PRIDEi Q6NXT4.

    Protocols and materials databases

    DNASUi 55676.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000282587 ; ENSP00000282587 ; ENSG00000152683 . [Q6NXT4-1 ]
    ENST00000379343 ; ENSP00000368648 ; ENSG00000152683 . [Q6NXT4-2 ]
    ENST00000435660 ; ENSP00000399005 ; ENSG00000152683 . [Q6NXT4-3 ]
    GeneIDi 55676.
    KEGGi hsa:55676.
    UCSCi uc002roe.2. human. [Q6NXT4-1 ]
    uc002rof.2. human. [Q6NXT4-2 ]
    uc010ezr.2. human. [Q6NXT4-3 ]
    uc010ymw.2. human.

    Organism-specific databases

    CTDi 55676.
    GeneCardsi GC02P032390.
    H-InvDB HIX0001954.
    HGNCi HGNC:19305. SLC30A6.
    HPAi HPA055032.
    HPA057328.
    MIMi 611148. gene.
    neXtProti NX_Q6NXT4.
    PharmGKBi PA134923067.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG1230.
    HOGENOMi HOG000060341.
    HOVERGENi HBG106400.
    KOi K14693.
    OMAi PSRYGTN.
    PhylomeDBi Q6NXT4.
    TreeFami TF313167.

    Enzyme and pathway databases

    Reactomei REACT_15550. Insulin processing.
    REACT_20582. Zinc efflux and compartmentalization by the SLC30 family.

    Miscellaneous databases

    ChiTaRSi SLC30A6. human.
    GenomeRNAii 55676.
    NextBioi 60456.
    PROi Q6NXT4.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q6NXT4.
    Bgeei Q6NXT4.
    CleanExi HS_SLC30A6.
    Genevestigatori Q6NXT4.

    Family and domain databases

    Gene3Di 1.20.1510.10. 1 hit.
    InterProi IPR002524. Cation_efflux.
    IPR027469. Cation_efflux_TMD.
    [Graphical view ]
    PANTHERi PTHR11562. PTHR11562. 1 hit.
    Pfami PF01545. Cation_efflux. 1 hit.
    [Graphical view ]
    TIGRFAMsi TIGR01297. CDF. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4).
      Tissue: Trachea.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
      Tissue: Seminoma and Uterus.
    3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Brain and Eye.
    6. "In silico identification and expression of SLC30 family genes: an expressed sequence tag data mining strategy for the characterization of zinc transporters' tissue expression."
      Seve M., Chimienti F., Devergnas S., Favier A.
      BMC Genomics 5:32-32(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    7. "Altered expression of zinc transporters-4 and -6 in mild cognitive impairment, early and late Alzheimer's disease brain."
      Smith J.L., Xiong S., Markesbery W.R., Lovell M.A.
      Neuroscience 140:879-888(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    8. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
      Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
      Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.

    Entry informationi

    Entry nameiZNT6_HUMAN
    AccessioniPrimary (citable) accession number: Q6NXT4
    Secondary accession number(s): A5YM45
    , B7Z901, Q8N5C9, Q96NC3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 4, 2007
    Last sequence update: December 4, 2007
    Last modified: October 1, 2014
    This is version 89 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    Seems to have lost most of the histidine residues in the loop between the fourth and fifth transmembrane regions and appears to exert transport function by forming complexes with ZNT5.By similarity

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3