Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q6NXT4 (ZNT6_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 87. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Zinc transporter 6

Short name=ZnT-6
Alternative name(s):
Solute carrier family 30 member 6
Gene names
Name:SLC30A6
Synonyms:ZNT6
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length461 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Zinc-efflux transporter which allocates the cytoplasmic zinc to the trans-Golgi network (TGN) as well as the vesicular compartment By similarity.

Subunit structure

Heterooligomer. Interacts with ZNT5 By similarity.

Subcellular location

Golgi apparatustrans-Golgi network membrane; Multi-pass membrane protein. Note: Found in vesicles By similarity.

Tissue specificity

Expressed in brain; especially in cerebellum, hippocampus, parahippocampal gyrus, superior and middle temporal gyrus. Also expressed in B-cells, colon, eye, and lung. Lower expression was present in bone, brain, cervix, ear, heart, kidney, muscle, nerve, pancreas, prostate, skin, stomach, and testis. Ref.6 Ref.7

Miscellaneous

Seems to have lost most of the histidine residues in the loop between the fourth and fifth transmembrane regions and appears to exert transport function by forming complexes with ZNT5 By similarity.

Sequence similarities

Belongs to the cation diffusion facilitator (CDF) transporter (TC 2.A.4) family. SLC30A subfamily. [View classification]

Sequence caution

The sequence AAH32525.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q6NXT4-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q6NXT4-2)

The sequence of this isoform differs from the canonical sequence as follows:
     72-72: F → FRDGVSPFWLGWSQTPDLKWSTHLGLPKCWDNRRELPCLSN
Note: No experimental confirmation available.
Isoform 4 (identifier: Q6NXT4-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MGTIHLFRKPQRSFFGKLLREFRLVAADRR → M
Note: No experimental confirmation available.
Isoform 3 (identifier: Q6NXT4-3)

The sequence of this isoform differs from the canonical sequence as follows:
     273-295: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 461461Zinc transporter 6
PRO_0000312573

Regions

Topological domain1 – 3333Cytoplasmic Potential
Transmembrane34 – 5421Helical; Potential
Topological domain55 – 6410Extracellular Potential
Transmembrane65 – 8521Helical; Potential
Topological domain86 – 9813Cytoplasmic Potential
Transmembrane99 – 11921Helical; Potential
Topological domain120 – 13415Extracellular Potential
Transmembrane135 – 15521Helical; Potential
Topological domain156 – 20045Cytoplasmic Potential
Transmembrane201 – 22121Helical; Potential
Topological domain222 – 2232Extracellular Potential
Transmembrane224 – 24421Helical; Potential
Topological domain245 – 461217Cytoplasmic Potential

Natural variations

Alternative sequence1 – 3030MGTIH…AADRR → M in isoform 4.
VSP_045198
Alternative sequence721F → FRDGVSPFWLGWSQTPDLKW STHLGLPKCWDNRRELPCLS N in isoform 2.
VSP_029861
Alternative sequence273 – 29523Missing in isoform 3.
VSP_029862

Experimental info

Sequence conflict198 – 1992MN → TR in AAH32525. Ref.5
Sequence conflict4541N → S in AAH66903. Ref.5

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified December 4, 2007. Version 2.
Checksum: 7926F6888EF1F1F9

FASTA46151,116
        10         20         30         40         50         60 
MGTIHLFRKP QRSFFGKLLR EFRLVAADRR SWKILLFGVI NLICTGFLLM WCSSTNSIAL 

        70         80         90        100        110        120 
TAYTYLTIFD LFSLMTCLIS YWVTLRKPSP VYSFGFERLE VLAVFASTVL AQLGALFILK 

       130        140        150        160        170        180 
ESAERFLEQP EIHTGRLLVG TFVALCFNLF TMLSIRNKPF AYVSEAASTS WLQEHVADLS 

       190        200        210        220        230        240 
RSLCGIIPGL SSIFLPRMNP FVLIDLAGAF ALCITYMLIE INNYFAVDTA SAIAIALMTF 

       250        260        270        280        290        300 
GTMYPMSVYS GKVLLQTTPP HVIGQLDKLI REVSTLDGVL EVRNEHFWTL GFGSLAGSVH 

       310        320        330        340        350        360 
VRIRRDANEQ MVLAHVTNRL YTLVSTLTVQ IFKDDWIRPA LLSGPVAANV LNFSDHHVIP 

       370        380        390        400        410        420 
MPLLKGTDDL NPVTSTPAKP SSPPPEFSFN TPGKNVNPVI LLNTQTRPYG FGLNHGHTPY 

       430        440        450        460 
SSMLNQGLGV PGIGATQGLR TGFTNIPSRY GTNNRIGQPR P 

« Hide

Isoform 2 [UniParc].

Checksum: B685D2C0FADA5105
Show »

FASTA50155,795
Isoform 4 [UniParc].

Checksum: EBC38BF0D245D824
Show »

FASTA43247,617
Isoform 3 [UniParc].

Checksum: AD591DAF786B8385
Show »

FASTA43848,557

References

« Hide 'large scale' references
[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4).
Tissue: Trachea.
[2]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
Tissue: Seminoma and Uterus.
[3]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Brain and Eye.
[6]"In silico identification and expression of SLC30 family genes: an expressed sequence tag data mining strategy for the characterization of zinc transporters' tissue expression."
Seve M., Chimienti F., Devergnas S., Favier A.
BMC Genomics 5:32-32(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
[7]"Altered expression of zinc transporters-4 and -6 in mild cognitive impairment, early and late Alzheimer's disease brain."
Smith J.L., Xiong S., Markesbery W.R., Lovell M.A.
Neuroscience 140:879-888(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
[8]"Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[9]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK055663 mRNA. Translation: BAB70980.1.
AK304225 mRNA. Translation: BAH14137.1.
EF560719 mRNA. Translation: ABQ59029.1.
EF560726 mRNA. Translation: ABQ59036.1.
AL121653 Genomic DNA. No translation available.
AL121658 Genomic DNA. No translation available.
CH471053 Genomic DNA. Translation: EAX00456.1.
BC032525 mRNA. Translation: AAH32525.1. Different initiation.
BC066903 mRNA. Translation: AAH66903.1.
CCDSCCDS1780.1. [Q6NXT4-1]
CCDS54341.1. [Q6NXT4-2]
CCDS54342.1. [Q6NXT4-3]
CCDS54343.1. [Q6NXT4-4]
RefSeqNP_001180442.1. NM_001193513.1. [Q6NXT4-2]
NP_001180443.1. NM_001193514.1. [Q6NXT4-3]
NP_001180444.1. NM_001193515.1. [Q6NXT4-4]
NP_060434.2. NM_017964.3. [Q6NXT4-1]
UniGeneHs.23248.

3D structure databases

ProteinModelPortalQ6NXT4.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid120806. 1 interaction.
IntActQ6NXT4. 1 interaction.
STRING9606.ENSP00000282587.

Protein family/group databases

TCDB2.A.4.4.4. the cation diffusion facilitator (cdf) family.

PTM databases

PhosphoSiteQ6NXT4.

Polymorphism databases

DMDM162416263.

Proteomic databases

MaxQBQ6NXT4.
PaxDbQ6NXT4.
PRIDEQ6NXT4.

Protocols and materials databases

DNASU55676.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000282587; ENSP00000282587; ENSG00000152683. [Q6NXT4-1]
ENST00000379343; ENSP00000368648; ENSG00000152683. [Q6NXT4-2]
ENST00000435660; ENSP00000399005; ENSG00000152683. [Q6NXT4-3]
ENST00000538303; ENSP00000440678; ENSG00000152683. [Q6NXT4-4]
GeneID55676.
KEGGhsa:55676.
UCSCuc002roe.2. human. [Q6NXT4-1]
uc002rof.2. human. [Q6NXT4-2]
uc010ezr.2. human. [Q6NXT4-3]
uc010ymw.2. human.

Organism-specific databases

CTD55676.
GeneCardsGC02P032390.
H-InvDBHIX0001954.
HGNCHGNC:19305. SLC30A6.
HPAHPA055032.
HPA057328.
MIM611148. gene.
neXtProtNX_Q6NXT4.
PharmGKBPA134923067.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG1230.
HOGENOMHOG000060341.
HOVERGENHBG106400.
KOK14693.
OMAPSRYGTN.
PhylomeDBQ6NXT4.
TreeFamTF313167.

Enzyme and pathway databases

ReactomeREACT_15518. Transmembrane transport of small molecules.
REACT_17015. Metabolism of proteins.

Gene expression databases

ArrayExpressQ6NXT4.
BgeeQ6NXT4.
CleanExHS_SLC30A6.
GenevestigatorQ6NXT4.

Family and domain databases

Gene3D1.20.1510.10. 1 hit.
InterProIPR002524. Cation_efflux.
IPR027469. Cation_efflux_TMD.
[Graphical view]
PANTHERPTHR11562. PTHR11562. 1 hit.
PfamPF01545. Cation_efflux. 1 hit.
[Graphical view]
TIGRFAMsTIGR01297. CDF. 1 hit.
ProtoNetSearch...

Other

ChiTaRSSLC30A6. human.
GenomeRNAi55676.
NextBio60456.
PROQ6NXT4.
SOURCESearch...

Entry information

Entry nameZNT6_HUMAN
AccessionPrimary (citable) accession number: Q6NXT4
Secondary accession number(s): A5YM45 expand/collapse secondary AC list , B7Z901, Q8N5C9, Q96NC3
Entry history
Integrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: December 4, 2007
Last modified: July 9, 2014
This is version 87 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 2

Human chromosome 2: entries, gene names and cross-references to MIM