Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc transporter 6

Gene

SLC30A6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Zinc-efflux transporter which allocates the cytoplasmic zinc to the trans-Golgi network (TGN) as well as the vesicular compartment.By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Ion transport, Transport, Zinc transport

Keywords - Ligandi

Zinc

Enzyme and pathway databases

ReactomeiREACT_15550. Insulin processing.
REACT_20582. Zinc efflux and compartmentalization by the SLC30 family.

Protein family/group databases

TCDBi2.A.4.4.4. the cation diffusion facilitator (cdf) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc transporter 6
Short name:
ZnT-6
Alternative name(s):
Solute carrier family 30 member 6
Gene namesi
Name:SLC30A6
Synonyms:ZNT6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:19305. SLC30A6.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 3333CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei34 – 5421HelicalSequence AnalysisAdd
BLAST
Topological domaini55 – 6410ExtracellularSequence Analysis
Transmembranei65 – 8521HelicalSequence AnalysisAdd
BLAST
Topological domaini86 – 9813CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei99 – 11921HelicalSequence AnalysisAdd
BLAST
Topological domaini120 – 13415ExtracellularSequence AnalysisAdd
BLAST
Transmembranei135 – 15521HelicalSequence AnalysisAdd
BLAST
Topological domaini156 – 20045CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei201 – 22121HelicalSequence AnalysisAdd
BLAST
Topological domaini222 – 2232ExtracellularSequence Analysis
Transmembranei224 – 24421HelicalSequence AnalysisAdd
BLAST
Topological domaini245 – 461217CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  • Golgi apparatus Source: BHF-UCL
  • Golgi membrane Source: Reactome
  • integral component of membrane Source: UniProtKB-KW
  • mitochondrion Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134923067.

Polymorphism and mutation databases

BioMutaiSLC30A6.
DMDMi162416263.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 461461Zinc transporter 6PRO_0000312573Add
BLAST

Proteomic databases

MaxQBiQ6NXT4.
PaxDbiQ6NXT4.
PRIDEiQ6NXT4.

PTM databases

PhosphoSiteiQ6NXT4.

Expressioni

Tissue specificityi

Expressed in brain; especially in cerebellum, hippocampus, parahippocampal gyrus, superior and middle temporal gyrus. Also expressed in B-cells, colon, eye, and lung. Lower expression was present in bone, brain, cervix, ear, heart, kidney, muscle, nerve, pancreas, prostate, skin, stomach, and testis.2 Publications

Gene expression databases

BgeeiQ6NXT4.
CleanExiHS_SLC30A6.
ExpressionAtlasiQ6NXT4. baseline and differential.
GenevisibleiQ6NXT4. HS.

Organism-specific databases

HPAiHPA055032.
HPA057328.

Interactioni

Subunit structurei

Heterooligomer. Interacts with ZNT5 (By similarity).By similarity

Protein-protein interaction databases

BioGridi120806. 8 interactions.
IntActiQ6NXT4. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ6NXT4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG1230.
GeneTreeiENSGT00630000089781.
HOGENOMiHOG000060341.
HOVERGENiHBG106400.
InParanoidiQ6NXT4.
KOiK14693.
OMAiPSRYGTN.
PhylomeDBiQ6NXT4.
TreeFamiTF313167.

Family and domain databases

Gene3Di1.20.1510.10. 1 hit.
InterProiIPR002524. Cation_efflux.
IPR027469. Cation_efflux_TMD.
[Graphical view]
PANTHERiPTHR11562. PTHR11562. 1 hit.
PfamiPF01545. Cation_efflux. 1 hit.
[Graphical view]
TIGRFAMsiTIGR01297. CDF. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6NXT4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGTIHLFRKP QRSFFGKLLR EFRLVAADRR SWKILLFGVI NLICTGFLLM
60 70 80 90 100
WCSSTNSIAL TAYTYLTIFD LFSLMTCLIS YWVTLRKPSP VYSFGFERLE
110 120 130 140 150
VLAVFASTVL AQLGALFILK ESAERFLEQP EIHTGRLLVG TFVALCFNLF
160 170 180 190 200
TMLSIRNKPF AYVSEAASTS WLQEHVADLS RSLCGIIPGL SSIFLPRMNP
210 220 230 240 250
FVLIDLAGAF ALCITYMLIE INNYFAVDTA SAIAIALMTF GTMYPMSVYS
260 270 280 290 300
GKVLLQTTPP HVIGQLDKLI REVSTLDGVL EVRNEHFWTL GFGSLAGSVH
310 320 330 340 350
VRIRRDANEQ MVLAHVTNRL YTLVSTLTVQ IFKDDWIRPA LLSGPVAANV
360 370 380 390 400
LNFSDHHVIP MPLLKGTDDL NPVTSTPAKP SSPPPEFSFN TPGKNVNPVI
410 420 430 440 450
LLNTQTRPYG FGLNHGHTPY SSMLNQGLGV PGIGATQGLR TGFTNIPSRY
460
GTNNRIGQPR P
Length:461
Mass (Da):51,116
Last modified:December 4, 2007 - v2
Checksum:i7926F6888EF1F1F9
GO
Isoform 2 (identifier: Q6NXT4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     72-72: F → FRDGVSPFWLGWSQTPDLKWSTHLGLPKCWDNRRELPCLSN

Note: No experimental confirmation available.
Show »
Length:501
Mass (Da):55,795
Checksum:iB685D2C0FADA5105
GO
Isoform 4 (identifier: Q6NXT4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MGTIHLFRKPQRSFFGKLLREFRLVAADRR → M

Note: No experimental confirmation available.
Show »
Length:432
Mass (Da):47,617
Checksum:iEBC38BF0D245D824
GO
Isoform 3 (identifier: Q6NXT4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     273-295: Missing.

Note: No experimental confirmation available.
Show »
Length:438
Mass (Da):48,557
Checksum:iAD591DAF786B8385
GO

Sequence cautioni

The sequence AAH32525.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti198 – 1992MN → TR in AAH32525 (PubMed:15489334).Curated
Sequence conflicti454 – 4541N → S in AAH66903 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3030MGTIH…AADRR → M in isoform 4. 1 PublicationVSP_045198Add
BLAST
Alternative sequencei72 – 721F → FRDGVSPFWLGWSQTPDLKW STHLGLPKCWDNRRELPCLS N in isoform 2. 1 PublicationVSP_029861
Alternative sequencei273 – 29523Missing in isoform 3. 1 PublicationVSP_029862Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK055663 mRNA. Translation: BAB70980.1.
AK304225 mRNA. Translation: BAH14137.1.
EF560719 mRNA. Translation: ABQ59029.1.
EF560726 mRNA. Translation: ABQ59036.1.
AL121653 Genomic DNA. No translation available.
AL121658 Genomic DNA. No translation available.
CH471053 Genomic DNA. Translation: EAX00456.1.
BC032525 mRNA. Translation: AAH32525.1. Different initiation.
BC066903 mRNA. Translation: AAH66903.1.
CCDSiCCDS1780.1. [Q6NXT4-1]
CCDS54341.1. [Q6NXT4-2]
CCDS54342.1. [Q6NXT4-3]
CCDS54343.1. [Q6NXT4-4]
RefSeqiNP_001180442.1. NM_001193513.1. [Q6NXT4-2]
NP_001180443.1. NM_001193514.1. [Q6NXT4-3]
NP_001180444.1. NM_001193515.1. [Q6NXT4-4]
NP_060434.2. NM_017964.3. [Q6NXT4-1]
UniGeneiHs.23248.

Genome annotation databases

EnsembliENST00000282587; ENSP00000282587; ENSG00000152683.
ENST00000357055; ENSP00000349563; ENSG00000152683. [Q6NXT4-4]
ENST00000379343; ENSP00000368648; ENSG00000152683. [Q6NXT4-2]
ENST00000435660; ENSP00000399005; ENSG00000152683. [Q6NXT4-3]
GeneIDi55676.
KEGGihsa:55676.
UCSCiuc002roe.2. human. [Q6NXT4-1]
uc002rof.2. human. [Q6NXT4-2]
uc010ezr.2. human. [Q6NXT4-3]
uc010ymw.2. human.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK055663 mRNA. Translation: BAB70980.1.
AK304225 mRNA. Translation: BAH14137.1.
EF560719 mRNA. Translation: ABQ59029.1.
EF560726 mRNA. Translation: ABQ59036.1.
AL121653 Genomic DNA. No translation available.
AL121658 Genomic DNA. No translation available.
CH471053 Genomic DNA. Translation: EAX00456.1.
BC032525 mRNA. Translation: AAH32525.1. Different initiation.
BC066903 mRNA. Translation: AAH66903.1.
CCDSiCCDS1780.1. [Q6NXT4-1]
CCDS54341.1. [Q6NXT4-2]
CCDS54342.1. [Q6NXT4-3]
CCDS54343.1. [Q6NXT4-4]
RefSeqiNP_001180442.1. NM_001193513.1. [Q6NXT4-2]
NP_001180443.1. NM_001193514.1. [Q6NXT4-3]
NP_001180444.1. NM_001193515.1. [Q6NXT4-4]
NP_060434.2. NM_017964.3. [Q6NXT4-1]
UniGeneiHs.23248.

3D structure databases

ProteinModelPortaliQ6NXT4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120806. 8 interactions.
IntActiQ6NXT4. 1 interaction.

Protein family/group databases

TCDBi2.A.4.4.4. the cation diffusion facilitator (cdf) family.

PTM databases

PhosphoSiteiQ6NXT4.

Polymorphism and mutation databases

BioMutaiSLC30A6.
DMDMi162416263.

Proteomic databases

MaxQBiQ6NXT4.
PaxDbiQ6NXT4.
PRIDEiQ6NXT4.

Protocols and materials databases

DNASUi55676.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000282587; ENSP00000282587; ENSG00000152683.
ENST00000357055; ENSP00000349563; ENSG00000152683. [Q6NXT4-4]
ENST00000379343; ENSP00000368648; ENSG00000152683. [Q6NXT4-2]
ENST00000435660; ENSP00000399005; ENSG00000152683. [Q6NXT4-3]
GeneIDi55676.
KEGGihsa:55676.
UCSCiuc002roe.2. human. [Q6NXT4-1]
uc002rof.2. human. [Q6NXT4-2]
uc010ezr.2. human. [Q6NXT4-3]
uc010ymw.2. human.

Organism-specific databases

CTDi55676.
GeneCardsiGC02P032390.
H-InvDBHIX0001954.
HGNCiHGNC:19305. SLC30A6.
HPAiHPA055032.
HPA057328.
MIMi611148. gene.
neXtProtiNX_Q6NXT4.
PharmGKBiPA134923067.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG1230.
GeneTreeiENSGT00630000089781.
HOGENOMiHOG000060341.
HOVERGENiHBG106400.
InParanoidiQ6NXT4.
KOiK14693.
OMAiPSRYGTN.
PhylomeDBiQ6NXT4.
TreeFamiTF313167.

Enzyme and pathway databases

ReactomeiREACT_15550. Insulin processing.
REACT_20582. Zinc efflux and compartmentalization by the SLC30 family.

Miscellaneous databases

ChiTaRSiSLC30A6. human.
GenomeRNAii55676.
NextBioi60456.
PROiQ6NXT4.
SOURCEiSearch...

Gene expression databases

BgeeiQ6NXT4.
CleanExiHS_SLC30A6.
ExpressionAtlasiQ6NXT4. baseline and differential.
GenevisibleiQ6NXT4. HS.

Family and domain databases

Gene3Di1.20.1510.10. 1 hit.
InterProiIPR002524. Cation_efflux.
IPR027469. Cation_efflux_TMD.
[Graphical view]
PANTHERiPTHR11562. PTHR11562. 1 hit.
PfamiPF01545. Cation_efflux. 1 hit.
[Graphical view]
TIGRFAMsiTIGR01297. CDF. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4).
    Tissue: Trachea.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: Seminoma and Uterus.
  3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain and Eye.
  6. "In silico identification and expression of SLC30 family genes: an expressed sequence tag data mining strategy for the characterization of zinc transporters' tissue expression."
    Seve M., Chimienti F., Devergnas S., Favier A.
    BMC Genomics 5:32-32(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  7. "Altered expression of zinc transporters-4 and -6 in mild cognitive impairment, early and late Alzheimer's disease brain."
    Smith J.L., Xiong S., Markesbery W.R., Lovell M.A.
    Neuroscience 140:879-888(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  8. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiZNT6_HUMAN
AccessioniPrimary (citable) accession number: Q6NXT4
Secondary accession number(s): A5YM45
, B7Z901, Q8N5C9, Q96NC3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: December 4, 2007
Last modified: July 22, 2015
This is version 97 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Seems to have lost most of the histidine residues in the loop between the fourth and fifth transmembrane regions and appears to exert transport function by forming complexes with ZNT5.By similarity

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.