Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Receptor expression-enhancing protein 3

Gene

REEP3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Microtubule-binding protein required to ensure proper cell division and nuclear envelope reassembly by sequestering the endoplasmic reticulum away from chromosomes during mitosis. Probably acts by clearing the endoplasmic reticulum membrane from metaphase chromosomes.1 Publication

GO - Biological processi

  • cell division Source: UniProtKB-KW
  • mitotic nuclear division Source: UniProtKB-KW
  • mitotic nuclear envelope reassembly Source: UniProtKB
  • nuclear envelope organization Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Cell cycle, Cell division, Mitosis

Names & Taxonomyi

Protein namesi
Recommended name:
Receptor expression-enhancing protein 3
Gene namesi
Name:REEP3
Synonyms:C10orf74
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:23711. REEP3.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei1 – 21HelicalSequence analysisAdd BLAST21
Transmembranei35 – 55HelicalSequence analysisAdd BLAST21
Transmembranei59 – 79HelicalSequence analysisAdd BLAST21

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Microtubule

Pathology & Biotechi

Organism-specific databases

DisGeNETi221035.
OpenTargetsiENSG00000165476.
PharmGKBiPA134863406.

Polymorphism and mutation databases

BioMutaiREEP3.
DMDMi74736808.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001018261 – 255Receptor expression-enhancing protein 3Add BLAST255

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei201PhosphothreonineCombined sources1
Modified residuei210PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ6NUK4.
PaxDbiQ6NUK4.
PeptideAtlasiQ6NUK4.
PRIDEiQ6NUK4.

PTM databases

iPTMnetiQ6NUK4.
PhosphoSitePlusiQ6NUK4.

Expressioni

Tissue specificityi

Expressed in circumvallate papillae.1 Publication

Gene expression databases

BgeeiENSG00000165476.
CleanExiHS_REEP3.
ExpressionAtlasiQ6NUK4. baseline and differential.
GenevisibleiQ6NUK4. HS.

Interactioni

Protein-protein interaction databases

BioGridi128676. 5 interactors.
IntActiQ6NUK4. 6 interactors.
MINTiMINT-3976601.
STRINGi9606.ENSP00000362863.

Structurei

3D structure databases

ProteinModelPortaliQ6NUK4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the DP1 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1726. Eukaryota.
COG5052. LUCA.
GeneTreeiENSGT00550000074535.
HOGENOMiHOG000007472.
HOVERGENiHBG056861.
InParanoidiQ6NUK4.
KOiK17338.
OMAiWMISRAV.
OrthoDBiEOG091G0X58.
PhylomeDBiQ6NUK4.
TreeFamiTF314177.

Family and domain databases

InterProiIPR004345. TB2_DP1_HVA22.
[Graphical view]
PANTHERiPTHR12300. PTHR12300. 1 hit.
PfamiPF03134. TB2_DP1_HVA22. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6NUK4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVSWMISRAV VLVFGMLYPA YYSYKAVKTK NVKEYVRWMM YWIVFALYTV
60 70 80 90 100
IETVADQTVA WFPLYYELKI AFVIWLLSPY TKGASLIYRK FLHPLLSSKE
110 120 130 140 150
REIDDYIVQA KERGYETMVN FGRQGLNLAA TAAVTAAVKS QGAITERLRS
160 170 180 190 200
FSMHDLTTIQ GDEPVGQRPY QPLPEAKKKS KPAPSESAGY GIPLKDGDEK
210 220 230 240 250
TDEEAEGPYS DNEMLTHKGL RRSQSMKSVK TTKGRKEVRY GSLKYKVKKR

PQVYF
Length:255
Mass (Da):29,264
Last modified:July 5, 2004 - v1
Checksum:i83E4D6E153DDE3EB
GO
Isoform 2 (identifier: Q6NUK4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     140-170: SQGAITERLRSFSMHDLTTIQGDEPVGQRPY → VIVHLPF
     171-255: Missing.

Note: No experimental confirmation available.
Show »
Length:146
Mass (Da):16,999
Checksum:i3EA4DBA71A853ACC
GO

Sequence cautioni

The sequence AAH10040 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_048926171Q → R.Corresponds to variant rs10995569dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_016634140 – 170SQGAI…GQRPY → VIVHLPF in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_016635171 – 255Missing in isoform 2. 1 PublicationAdd BLAST85

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY562241 mRNA. Translation: AAT70686.1.
AC022022 Genomic DNA. No translation available.
AL607062 Genomic DNA. Translation: CAI40732.1.
BC010040 mRNA. Translation: AAH10040.1. Sequence problems.
BC057832 mRNA. Translation: AAH57832.1.
BC068557 mRNA. Translation: AAH68557.1.
CCDSiCCDS44411.1. [Q6NUK4-1]
RefSeqiNP_001001330.1. NM_001001330.2. [Q6NUK4-1]
UniGeneiHs.499833.

Genome annotation databases

EnsembliENST00000373758; ENSP00000362863; ENSG00000165476. [Q6NUK4-1]
GeneIDi221035.
KEGGihsa:221035.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY562241 mRNA. Translation: AAT70686.1.
AC022022 Genomic DNA. No translation available.
AL607062 Genomic DNA. Translation: CAI40732.1.
BC010040 mRNA. Translation: AAH10040.1. Sequence problems.
BC057832 mRNA. Translation: AAH57832.1.
BC068557 mRNA. Translation: AAH68557.1.
CCDSiCCDS44411.1. [Q6NUK4-1]
RefSeqiNP_001001330.1. NM_001001330.2. [Q6NUK4-1]
UniGeneiHs.499833.

3D structure databases

ProteinModelPortaliQ6NUK4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128676. 5 interactors.
IntActiQ6NUK4. 6 interactors.
MINTiMINT-3976601.
STRINGi9606.ENSP00000362863.

PTM databases

iPTMnetiQ6NUK4.
PhosphoSitePlusiQ6NUK4.

Polymorphism and mutation databases

BioMutaiREEP3.
DMDMi74736808.

Proteomic databases

EPDiQ6NUK4.
PaxDbiQ6NUK4.
PeptideAtlasiQ6NUK4.
PRIDEiQ6NUK4.

Protocols and materials databases

DNASUi221035.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000373758; ENSP00000362863; ENSG00000165476. [Q6NUK4-1]
GeneIDi221035.
KEGGihsa:221035.

Organism-specific databases

CTDi221035.
DisGeNETi221035.
GeneCardsiREEP3.
HGNCiHGNC:23711. REEP3.
MIMi609348. gene.
neXtProtiNX_Q6NUK4.
OpenTargetsiENSG00000165476.
PharmGKBiPA134863406.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1726. Eukaryota.
COG5052. LUCA.
GeneTreeiENSGT00550000074535.
HOGENOMiHOG000007472.
HOVERGENiHBG056861.
InParanoidiQ6NUK4.
KOiK17338.
OMAiWMISRAV.
OrthoDBiEOG091G0X58.
PhylomeDBiQ6NUK4.
TreeFamiTF314177.

Miscellaneous databases

ChiTaRSiREEP3. human.
GenomeRNAii221035.
PROiQ6NUK4.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000165476.
CleanExiHS_REEP3.
ExpressionAtlasiQ6NUK4. baseline and differential.
GenevisibleiQ6NUK4. HS.

Family and domain databases

InterProiIPR004345. TB2_DP1_HVA22.
[Graphical view]
PANTHERiPTHR12300. PTHR12300. 1 hit.
PfamiPF03134. TB2_DP1_HVA22. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiREEP3_HUMAN
AccessioniPrimary (citable) accession number: Q6NUK4
Secondary accession number(s): Q5JQR5
, Q5QGT2, Q6PEW8, Q6PJY4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 20, 2005
Last sequence update: July 5, 2004
Last modified: November 2, 2016
This is version 104 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.