Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6NUK4

- REEP3_HUMAN

UniProt

Q6NUK4 - REEP3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Receptor expression-enhancing protein 3

Gene

REEP3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli

Functioni

Microtubule-binding protein required to ensure proper cell division and nuclear envelope reassembly by sequestering the endoplasmic reticulum away from chromosomes during mitosis. Probably acts by clearing the endoplasmic reticulum membrane from metaphase chromosomes.1 Publication

GO - Biological processi

  1. mitotic nuclear division Source: UniProtKB-KW
  2. mitotic nuclear envelope reassembly Source: UniProtKB
  3. nuclear envelope organization Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Cell cycle, Cell division, Mitosis

Names & Taxonomyi

Protein namesi
Recommended name:
Receptor expression-enhancing protein 3
Gene namesi
Name:REEP3
Synonyms:C10orf74
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 10

Organism-specific databases

HGNCiHGNC:23711. REEP3.

Subcellular locationi

GO - Cellular componenti

  1. endoplasmic reticulum Source: UniProtKB-KW
  2. integral component of membrane Source: UniProtKB-KW
  3. microtubule Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Microtubule

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134863406.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 255255Receptor expression-enhancing protein 3PRO_0000101826Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei201 – 2011Phosphothreonine1 Publication
Modified residuei210 – 2101Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ6NUK4.
PaxDbiQ6NUK4.
PRIDEiQ6NUK4.

PTM databases

PhosphoSiteiQ6NUK4.

Expressioni

Gene expression databases

BgeeiQ6NUK4.
CleanExiHS_REEP3.
ExpressionAtlasiQ6NUK4. baseline and differential.
GenevestigatoriQ6NUK4.

Interactioni

Protein-protein interaction databases

BioGridi128676. 2 interactions.
IntActiQ6NUK4. 1 interaction.
MINTiMINT-3976601.
STRINGi9606.ENSP00000362863.

Structurei

3D structure databases

ProteinModelPortaliQ6NUK4.
ModBaseiSearch...
MobiDBiSearch...

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei1 – 2121HelicalSequence AnalysisAdd
BLAST
Transmembranei35 – 5521HelicalSequence AnalysisAdd
BLAST
Transmembranei59 – 7921HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Sequence similaritiesi

Belongs to the DP1 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG5052.
HOGENOMiHOG000007472.
HOVERGENiHBG056861.
InParanoidiQ6NUK4.
KOiK17338.
OMAiHSEDEMF.
OrthoDBiEOG71RXJX.
PhylomeDBiQ6NUK4.
TreeFamiTF314177.

Family and domain databases

InterProiIPR004345. TB2_DP1_HVA22.
[Graphical view]
PANTHERiPTHR12300. PTHR12300. 1 hit.
PfamiPF03134. TB2_DP1_HVA22. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6NUK4) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVSWMISRAV VLVFGMLYPA YYSYKAVKTK NVKEYVRWMM YWIVFALYTV
60 70 80 90 100
IETVADQTVA WFPLYYELKI AFVIWLLSPY TKGASLIYRK FLHPLLSSKE
110 120 130 140 150
REIDDYIVQA KERGYETMVN FGRQGLNLAA TAAVTAAVKS QGAITERLRS
160 170 180 190 200
FSMHDLTTIQ GDEPVGQRPY QPLPEAKKKS KPAPSESAGY GIPLKDGDEK
210 220 230 240 250
TDEEAEGPYS DNEMLTHKGL RRSQSMKSVK TTKGRKEVRY GSLKYKVKKR

PQVYF
Length:255
Mass (Da):29,264
Last modified:July 5, 2004 - v1
Checksum:i83E4D6E153DDE3EB
GO
Isoform 2 (identifier: Q6NUK4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     140-170: SQGAITERLRSFSMHDLTTIQGDEPVGQRPY → VIVHLPF
     171-255: Missing.

Note: No experimental confirmation available.

Show »
Length:146
Mass (Da):16,999
Checksum:i3EA4DBA71A853ACC
GO

Sequence cautioni

The sequence AAH10040.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti171 – 1711Q → R.
Corresponds to variant rs10995569 [ dbSNP | Ensembl ].
VAR_048926

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei140 – 17031SQGAI…GQRPY → VIVHLPF in isoform 2. 1 PublicationVSP_016634Add
BLAST
Alternative sequencei171 – 25585Missing in isoform 2. 1 PublicationVSP_016635Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY562241 mRNA. Translation: AAT70686.1.
AC022022 Genomic DNA. No translation available.
AL607062 Genomic DNA. Translation: CAI40732.1.
BC010040 mRNA. Translation: AAH10040.1. Sequence problems.
BC057832 mRNA. Translation: AAH57832.1.
BC068557 mRNA. Translation: AAH68557.1.
CCDSiCCDS44411.1. [Q6NUK4-1]
RefSeqiNP_001001330.1. NM_001001330.2. [Q6NUK4-1]
UniGeneiHs.499833.

Genome annotation databases

EnsembliENST00000373758; ENSP00000362863; ENSG00000165476. [Q6NUK4-1]
GeneIDi221035.
KEGGihsa:221035.
UCSCiuc001jmt.3. human. [Q6NUK4-1]
uc009xpl.2. human. [Q6NUK4-2]

Polymorphism databases

DMDMi74736808.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY562241 mRNA. Translation: AAT70686.1 .
AC022022 Genomic DNA. No translation available.
AL607062 Genomic DNA. Translation: CAI40732.1 .
BC010040 mRNA. Translation: AAH10040.1 . Sequence problems.
BC057832 mRNA. Translation: AAH57832.1 .
BC068557 mRNA. Translation: AAH68557.1 .
CCDSi CCDS44411.1. [Q6NUK4-1 ]
RefSeqi NP_001001330.1. NM_001001330.2. [Q6NUK4-1 ]
UniGenei Hs.499833.

3D structure databases

ProteinModelPortali Q6NUK4.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 128676. 2 interactions.
IntActi Q6NUK4. 1 interaction.
MINTi MINT-3976601.
STRINGi 9606.ENSP00000362863.

PTM databases

PhosphoSitei Q6NUK4.

Polymorphism databases

DMDMi 74736808.

Proteomic databases

MaxQBi Q6NUK4.
PaxDbi Q6NUK4.
PRIDEi Q6NUK4.

Protocols and materials databases

DNASUi 221035.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000373758 ; ENSP00000362863 ; ENSG00000165476 . [Q6NUK4-1 ]
GeneIDi 221035.
KEGGi hsa:221035.
UCSCi uc001jmt.3. human. [Q6NUK4-1 ]
uc009xpl.2. human. [Q6NUK4-2 ]

Organism-specific databases

CTDi 221035.
GeneCardsi GC10P065281.
HGNCi HGNC:23711. REEP3.
MIMi 609348. gene.
neXtProti NX_Q6NUK4.
PharmGKBi PA134863406.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5052.
HOGENOMi HOG000007472.
HOVERGENi HBG056861.
InParanoidi Q6NUK4.
KOi K17338.
OMAi HSEDEMF.
OrthoDBi EOG71RXJX.
PhylomeDBi Q6NUK4.
TreeFami TF314177.

Miscellaneous databases

ChiTaRSi REEP3. human.
GenomeRNAii 221035.
NextBioi 91157.
PROi Q6NUK4.
SOURCEi Search...

Gene expression databases

Bgeei Q6NUK4.
CleanExi HS_REEP3.
ExpressionAtlasi Q6NUK4. baseline and differential.
Genevestigatori Q6NUK4.

Family and domain databases

InterProi IPR004345. TB2_DP1_HVA22.
[Graphical view ]
PANTHERi PTHR12300. PTHR12300. 1 hit.
Pfami PF03134. TB2_DP1_HVA22. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "RTP family members induce functional expression of mammalian odorant receptors."
    Saito H., Kubota M., Roberts R.W., Chi Q., Matsunami H.
    Cell 119:679-691(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  2. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Placenta and Uterus.
  4. "Identification and characterization of the TRIP8 and REEP3 genes on chromosome 10q21.3 as novel candidate genes for autism."
    Castermans D., Vermeesch J.R., Fryns J.P., Steyaert J.G., Van de Ven W.J., Creemers J.W., Devriendt K.
    Eur. J. Hum. Genet. 15:422-431(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION.
  5. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  6. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-201 AND SER-210, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  7. "REEP3/4 ensure endoplasmic reticulum clearance from metaphase chromatin and proper nuclear envelope architecture."
    Schlaitz A.L., Thompson J., Wong C.C., Yates J.R. III, Heald R.
    Dev. Cell 26:315-323(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.

Entry informationi

Entry nameiREEP3_HUMAN
AccessioniPrimary (citable) accession number: Q6NUK4
Secondary accession number(s): Q5JQR5
, Q5QGT2, Q6PEW8, Q6PJY4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 20, 2005
Last sequence update: July 5, 2004
Last modified: October 29, 2014
This is version 86 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3