Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6NUK4

- REEP3_HUMAN

UniProt

Q6NUK4 - REEP3_HUMAN

Protein

Receptor expression-enhancing protein 3

Gene

REEP3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 85 (01 Oct 2014)
      Sequence version 1 (05 Jul 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Microtubule-binding protein required to ensure proper cell division and nuclear envelope reassembly by sequestering the endoplasmic reticulum away from chromosomes during mitosis. Probably acts by clearing the endoplasmic reticulum membrane from metaphase chromosomes.1 Publication

    GO - Biological processi

    1. mitotic nuclear division Source: UniProtKB-KW
    2. mitotic nuclear envelope reassembly Source: UniProtKB
    3. nuclear envelope organization Source: UniProtKB

    Keywords - Biological processi

    Cell cycle, Cell division, Mitosis

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Receptor expression-enhancing protein 3
    Gene namesi
    Name:REEP3
    Synonyms:C10orf74
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 10

    Organism-specific databases

    HGNCiHGNC:23711. REEP3.

    Subcellular locationi

    GO - Cellular componenti

    1. endoplasmic reticulum membrane Source: UniProtKB-SubCell
    2. integral component of membrane Source: UniProtKB-KW
    3. microtubule Source: UniProtKB-KW

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane, Microtubule

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134863406.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 255255Receptor expression-enhancing protein 3PRO_0000101826Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei201 – 2011Phosphothreonine1 Publication
    Modified residuei210 – 2101Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ6NUK4.
    PaxDbiQ6NUK4.
    PRIDEiQ6NUK4.

    PTM databases

    PhosphoSiteiQ6NUK4.

    Expressioni

    Gene expression databases

    BgeeiQ6NUK4.
    CleanExiHS_REEP3.
    GenevestigatoriQ6NUK4.

    Interactioni

    Protein-protein interaction databases

    BioGridi128676. 2 interactions.
    IntActiQ6NUK4. 1 interaction.
    MINTiMINT-3976601.
    STRINGi9606.ENSP00000362863.

    Structurei

    3D structure databases

    ProteinModelPortaliQ6NUK4.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei1 – 2121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei35 – 5521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei59 – 7921HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the DP1 family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG5052.
    HOGENOMiHOG000007472.
    HOVERGENiHBG056861.
    InParanoidiQ6NUK4.
    KOiK17338.
    OMAiHSEDEMF.
    OrthoDBiEOG71RXJX.
    PhylomeDBiQ6NUK4.
    TreeFamiTF314177.

    Family and domain databases

    InterProiIPR004345. TB2_DP1_HVA22.
    [Graphical view]
    PANTHERiPTHR12300. PTHR12300. 1 hit.
    PfamiPF03134. TB2_DP1_HVA22. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6NUK4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MVSWMISRAV VLVFGMLYPA YYSYKAVKTK NVKEYVRWMM YWIVFALYTV    50
    IETVADQTVA WFPLYYELKI AFVIWLLSPY TKGASLIYRK FLHPLLSSKE 100
    REIDDYIVQA KERGYETMVN FGRQGLNLAA TAAVTAAVKS QGAITERLRS 150
    FSMHDLTTIQ GDEPVGQRPY QPLPEAKKKS KPAPSESAGY GIPLKDGDEK 200
    TDEEAEGPYS DNEMLTHKGL RRSQSMKSVK TTKGRKEVRY GSLKYKVKKR 250
    PQVYF 255
    Length:255
    Mass (Da):29,264
    Last modified:July 5, 2004 - v1
    Checksum:i83E4D6E153DDE3EB
    GO
    Isoform 2 (identifier: Q6NUK4-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         140-170: SQGAITERLRSFSMHDLTTIQGDEPVGQRPY → VIVHLPF
         171-255: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:146
    Mass (Da):16,999
    Checksum:i3EA4DBA71A853ACC
    GO

    Sequence cautioni

    The sequence AAH10040.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti171 – 1711Q → R.
    Corresponds to variant rs10995569 [ dbSNP | Ensembl ].
    VAR_048926

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei140 – 17031SQGAI…GQRPY → VIVHLPF in isoform 2. 1 PublicationVSP_016634Add
    BLAST
    Alternative sequencei171 – 25585Missing in isoform 2. 1 PublicationVSP_016635Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY562241 mRNA. Translation: AAT70686.1.
    AC022022 Genomic DNA. No translation available.
    AL607062 Genomic DNA. Translation: CAI40732.1.
    BC010040 mRNA. Translation: AAH10040.1. Sequence problems.
    BC057832 mRNA. Translation: AAH57832.1.
    BC068557 mRNA. Translation: AAH68557.1.
    CCDSiCCDS44411.1. [Q6NUK4-1]
    RefSeqiNP_001001330.1. NM_001001330.2. [Q6NUK4-1]
    UniGeneiHs.499833.

    Genome annotation databases

    EnsembliENST00000373758; ENSP00000362863; ENSG00000165476. [Q6NUK4-1]
    GeneIDi221035.
    KEGGihsa:221035.
    UCSCiuc001jmt.3. human. [Q6NUK4-1]
    uc009xpl.2. human. [Q6NUK4-2]

    Polymorphism databases

    DMDMi74736808.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY562241 mRNA. Translation: AAT70686.1 .
    AC022022 Genomic DNA. No translation available.
    AL607062 Genomic DNA. Translation: CAI40732.1 .
    BC010040 mRNA. Translation: AAH10040.1 . Sequence problems.
    BC057832 mRNA. Translation: AAH57832.1 .
    BC068557 mRNA. Translation: AAH68557.1 .
    CCDSi CCDS44411.1. [Q6NUK4-1 ]
    RefSeqi NP_001001330.1. NM_001001330.2. [Q6NUK4-1 ]
    UniGenei Hs.499833.

    3D structure databases

    ProteinModelPortali Q6NUK4.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 128676. 2 interactions.
    IntActi Q6NUK4. 1 interaction.
    MINTi MINT-3976601.
    STRINGi 9606.ENSP00000362863.

    PTM databases

    PhosphoSitei Q6NUK4.

    Polymorphism databases

    DMDMi 74736808.

    Proteomic databases

    MaxQBi Q6NUK4.
    PaxDbi Q6NUK4.
    PRIDEi Q6NUK4.

    Protocols and materials databases

    DNASUi 221035.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000373758 ; ENSP00000362863 ; ENSG00000165476 . [Q6NUK4-1 ]
    GeneIDi 221035.
    KEGGi hsa:221035.
    UCSCi uc001jmt.3. human. [Q6NUK4-1 ]
    uc009xpl.2. human. [Q6NUK4-2 ]

    Organism-specific databases

    CTDi 221035.
    GeneCardsi GC10P065281.
    HGNCi HGNC:23711. REEP3.
    MIMi 609348. gene.
    neXtProti NX_Q6NUK4.
    PharmGKBi PA134863406.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5052.
    HOGENOMi HOG000007472.
    HOVERGENi HBG056861.
    InParanoidi Q6NUK4.
    KOi K17338.
    OMAi HSEDEMF.
    OrthoDBi EOG71RXJX.
    PhylomeDBi Q6NUK4.
    TreeFami TF314177.

    Miscellaneous databases

    ChiTaRSi REEP3. human.
    GenomeRNAii 221035.
    NextBioi 91157.
    PROi Q6NUK4.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q6NUK4.
    CleanExi HS_REEP3.
    Genevestigatori Q6NUK4.

    Family and domain databases

    InterProi IPR004345. TB2_DP1_HVA22.
    [Graphical view ]
    PANTHERi PTHR12300. PTHR12300. 1 hit.
    Pfami PF03134. TB2_DP1_HVA22. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "RTP family members induce functional expression of mammalian odorant receptors."
      Saito H., Kubota M., Roberts R.W., Chi Q., Matsunami H.
      Cell 119:679-691(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    2. "The DNA sequence and comparative analysis of human chromosome 10."
      Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
      , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
      Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Placenta and Uterus.
    4. "Identification and characterization of the TRIP8 and REEP3 genes on chromosome 10q21.3 as novel candidate genes for autism."
      Castermans D., Vermeesch J.R., Fryns J.P., Steyaert J.G., Van de Ven W.J., Creemers J.W., Devriendt K.
      Eur. J. Hum. Genet. 15:422-431(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION.
    5. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    6. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-201 AND SER-210, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    7. "REEP3/4 ensure endoplasmic reticulum clearance from metaphase chromatin and proper nuclear envelope architecture."
      Schlaitz A.L., Thompson J., Wong C.C., Yates J.R. III, Heald R.
      Dev. Cell 26:315-323(2013) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.

    Entry informationi

    Entry nameiREEP3_HUMAN
    AccessioniPrimary (citable) accession number: Q6NUK4
    Secondary accession number(s): Q5JQR5
    , Q5QGT2, Q6PEW8, Q6PJY4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 20, 2005
    Last sequence update: July 5, 2004
    Last modified: October 1, 2014
    This is version 85 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 10
      Human chromosome 10: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3