Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q6NUK4 (REEP3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 81. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Receptor expression-enhancing protein 3
Gene names
Name:REEP3
Synonyms:C10orf74
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length255 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Microtubule-binding protein required to ensure proper cell division and nuclear envelope reassembly by sequestering the endoplasmic reticulum away from chromosomes during mitosis. Probably acts by clearing the endoplasmic reticulum membrane from metaphase chromosomes. Ref.7

Subcellular location

Endoplasmic reticulum membrane; Multi-pass membrane protein By similarity.

Sequence similarities

Belongs to the DP1 family.

Sequence caution

The sequence AAH10040.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q6NUK4-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q6NUK4-2)

The sequence of this isoform differs from the canonical sequence as follows:
     140-170: SQGAITERLRSFSMHDLTTIQGDEPVGQRPY → VIVHLPF
     171-255: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 255255Receptor expression-enhancing protein 3
PRO_0000101826

Regions

Transmembrane1 – 2121Helical; Potential
Transmembrane35 – 5521Helical; Potential
Transmembrane59 – 7921Helical; Potential

Amino acid modifications

Modified residue2011Phosphothreonine Ref.6
Modified residue2101Phosphoserine Ref.6

Natural variations

Alternative sequence140 – 17031SQGAI…GQRPY → VIVHLPF in isoform 2.
VSP_016634
Alternative sequence171 – 25585Missing in isoform 2.
VSP_016635
Natural variant1711Q → R.
Corresponds to variant rs10995569 [ dbSNP | Ensembl ].
VAR_048926

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 5, 2004. Version 1.
Checksum: 83E4D6E153DDE3EB

FASTA25529,264
        10         20         30         40         50         60 
MVSWMISRAV VLVFGMLYPA YYSYKAVKTK NVKEYVRWMM YWIVFALYTV IETVADQTVA 

        70         80         90        100        110        120 
WFPLYYELKI AFVIWLLSPY TKGASLIYRK FLHPLLSSKE REIDDYIVQA KERGYETMVN 

       130        140        150        160        170        180 
FGRQGLNLAA TAAVTAAVKS QGAITERLRS FSMHDLTTIQ GDEPVGQRPY QPLPEAKKKS 

       190        200        210        220        230        240 
KPAPSESAGY GIPLKDGDEK TDEEAEGPYS DNEMLTHKGL RRSQSMKSVK TTKGRKEVRY 

       250 
GSLKYKVKKR PQVYF 

« Hide

Isoform 2 [UniParc].

Checksum: 3EA4DBA71A853ACC
Show »

FASTA14616,999

References

« Hide 'large scale' references
[1]"RTP family members induce functional expression of mammalian odorant receptors."
Saito H., Kubota M., Roberts R.W., Chi Q., Matsunami H.
Cell 119:679-691(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
[2]"The DNA sequence and comparative analysis of human chromosome 10."
Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. expand/collapse author list , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Placenta and Uterus.
[4]"Identification and characterization of the TRIP8 and REEP3 genes on chromosome 10q21.3 as novel candidate genes for autism."
Castermans D., Vermeesch J.R., Fryns J.P., Steyaert J.G., Van de Ven W.J., Creemers J.W., Devriendt K.
Eur. J. Hum. Genet. 15:422-431(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION.
[5]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[6]"System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-201 AND SER-210, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[7]"REEP3/4 ensure endoplasmic reticulum clearance from metaphase chromatin and proper nuclear envelope architecture."
Schlaitz A.L., Thompson J., Wong C.C., Yates J.R. III, Heald R.
Dev. Cell 26:315-323(2013) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY562241 mRNA. Translation: AAT70686.1.
AC022022 Genomic DNA. No translation available.
AL607062 Genomic DNA. Translation: CAI40732.1.
BC010040 mRNA. Translation: AAH10040.1. Sequence problems.
BC057832 mRNA. Translation: AAH57832.1.
BC068557 mRNA. Translation: AAH68557.1.
RefSeqNP_001001330.1. NM_001001330.2.
UniGeneHs.499833.

3D structure databases

ProteinModelPortalQ6NUK4.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid128676. 2 interactions.
IntActQ6NUK4. 1 interaction.
MINTMINT-3976601.
STRING9606.ENSP00000362863.

PTM databases

PhosphoSiteQ6NUK4.

Polymorphism databases

DMDM74736808.

Proteomic databases

PaxDbQ6NUK4.
PRIDEQ6NUK4.

Protocols and materials databases

DNASU221035.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000373758; ENSP00000362863; ENSG00000165476. [Q6NUK4-1]
GeneID221035.
KEGGhsa:221035.
UCSCuc001jmt.3. human. [Q6NUK4-1]
uc009xpl.2. human. [Q6NUK4-2]

Organism-specific databases

CTD221035.
GeneCardsGC10P065281.
HGNCHGNC:23711. REEP3.
MIM609348. gene.
neXtProtNX_Q6NUK4.
PharmGKBPA134863406.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5052.
HOGENOMHOG000007472.
HOVERGENHBG056861.
InParanoidQ6NUK4.
KOK17338.
OMAWMISRAV.
OrthoDBEOG71RXJX.
PhylomeDBQ6NUK4.
TreeFamTF314177.

Gene expression databases

BgeeQ6NUK4.
CleanExHS_REEP3.
GenevestigatorQ6NUK4.

Family and domain databases

InterProIPR004345. TB2_DP1_HVA22.
[Graphical view]
PANTHERPTHR12300. PTHR12300. 1 hit.
PfamPF03134. TB2_DP1_HVA22. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSREEP3. human.
GenomeRNAi221035.
NextBio91157.
PROQ6NUK4.
SOURCESearch...

Entry information

Entry nameREEP3_HUMAN
AccessionPrimary (citable) accession number: Q6NUK4
Secondary accession number(s): Q5JQR5 expand/collapse secondary AC list , Q5QGT2, Q6PEW8, Q6PJY4
Entry history
Integrated into UniProtKB/Swiss-Prot: December 20, 2005
Last sequence update: July 5, 2004
Last modified: April 16, 2014
This is version 81 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 10

Human chromosome 10: entries, gene names and cross-references to MIM