Q6NUK4 (REEP3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 74.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Receptor expression-enhancing protein 3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 255 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May enhance the cell surface expression of odorant receptors By similarity. |
| Subunit structure | Interacts with odorant receptor proteins By similarity. |
| Subcellular location | Membrane; Multi-pass membrane protein By similarity. |
| Sequence similarities | Belongs to the DP1 family. |
| Sequence caution | The sequence AAH10040.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6NUK4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6NUK4-2) The sequence of this isoform differs from the canonical sequence as follows: 140-170: SQGAITERLRSFSMHDLTTIQGDEPVGQRPY → VIVHLPF 171-255: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 255 | 255 | Receptor expression-enhancing protein 3 | PRO_0000101826 | |||||
Regions | |||||||||
| Transmembrane | 1 – 21 | 21 | Helical; Potential | ||||||
| Transmembrane | 35 – 55 | 21 | Helical; Potential | ||||||
| Transmembrane | 59 – 79 | 21 | Helical; Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 150 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 152 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 201 | 1 | Phosphothreonine Ref.5 | ||||||
| Modified residue | 210 | 1 | Phosphoserine Ref.5 | ||||||
Natural variations | |||||||||
| Alternative sequence | 140 – 170 | 31 | SQGAI…GQRPY → VIVHLPF in isoform 2. | VSP_016634 | |||||
| Alternative sequence | 171 – 255 | 85 | Missing in isoform 2. | VSP_016635 | |||||
| Natural variant | 171 | 1 | Q → R. Corresponds to variant rs10995569 [ dbSNP | Ensembl ]. | VAR_048926 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "RTP family members induce functional expression of mammalian odorant receptors." Saito H., Kubota M., Roberts R.W., Chi Q., Matsunami H. Cell 119:679-691(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [2] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Placenta and Uterus. |
| [4] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [5] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-201 AND SER-210, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY562241 mRNA. Translation: AAT70686.1. AC022022 Genomic DNA. No translation available. AL607062 Genomic DNA. Translation: CAI40732.1. BC010040 mRNA. Translation: AAH10040.1. Sequence problems. BC057832 mRNA. Translation: AAH57832.1. BC068557 mRNA. Translation: AAH68557.1. |
| IPI | IPI00164434. IPI00658022. |
| RefSeq | NP_001001330.1. NM_001001330.2. |
| UniGene | Hs.499833. |
3D structure databases | |
| ProteinModelPortal | Q6NUK4. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-3976601. |
| STRING | 9606.ENSP00000362863. |
PTM databases | |
| PhosphoSite | Q6NUK4. |
Polymorphism databases | |
| DMDM | 74736808. |
Proteomic databases | |
| PaxDb | Q6NUK4. |
| PRIDE | Q6NUK4. |
Protocols and materials databases | |
| DNASU | 221035. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000298249; ENSP00000298249; ENSG00000165476. ENST00000373758; ENSP00000362863; ENSG00000165476. |
| GeneID | 221035. |
| KEGG | hsa:221035. |
| UCSC | uc001jmt.3. human. uc009xpl.2. human. |
Organism-specific databases | |
| CTD | 221035. |
| GeneCards | GC10P065281. |
| HGNC | HGNC:23711. REEP3. |
| MIM | 609348. gene. |
| neXtProt | NX_Q6NUK4. |
| PharmGKB | PA134863406. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG5052. |
| HOGENOM | HOG000007472. |
| HOVERGEN | HBG056861. |
| InParanoid | Q6NUK4. |
Gene expression databases | |
| Bgee | Q6NUK4. |
| CleanEx | HS_REEP3. |
| Genevestigator | Q6NUK4. |
| GermOnline | ENSG00000165476. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR004345. TB2_DP1_HVA22. [Graphical view] |
| PANTHER | PTHR12300. PTHR12300. 1 hit. |
| Pfam | PF03134. TB2_DP1_HVA22. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | REEP3. human. |
| GenomeRNAi | 221035. |
| NextBio | 91157. |
| SOURCE | Search... |
Entry information
| Entry name | REEP3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6NUK4 Secondary accession number(s): Q5JQR5 Q6PJY4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
