Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6NT76

- HMBX1_HUMAN

UniProt

Q6NT76 - HMBX1_HUMAN

Protein

Homeobox-containing protein 1

Gene

HMBOX1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 101 (01 Oct 2014)
      Sequence version 1 (05 Jul 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Transcription factor. Isoform 1 acts as a transcriptional repressor. Isoform 4 has very low activity as a transcriptional repressor.2 Publications

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    DNA bindingi267 – 34175HomeoboxPROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. protein binding Source: IntAct
    2. sequence-specific DNA binding Source: InterPro
    3. sequence-specific DNA binding transcription factor activity Source: InterPro

    GO - Biological processi

    1. negative regulation of transcription, DNA-templated Source: UniProtKB
    2. positive regulation of transcription, DNA-templated Source: InterPro
    3. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Molecular functioni

    Repressor

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Homeobox-containing protein 1
    Gene namesi
    Name:HMBOX1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 8

    Organism-specific databases

    HGNCiHGNC:26137. HMBOX1.

    Subcellular locationi

    Nucleus. Cytoplasm
    Note: Predominantly detected in cytoplasm.

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB
    2. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA143485490.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 420420Homeobox-containing protein 1PRO_0000233287Add
    BLAST

    Proteomic databases

    MaxQBiQ6NT76.
    PaxDbiQ6NT76.
    PRIDEiQ6NT76.

    PTM databases

    PhosphoSiteiQ6NT76.

    Expressioni

    Tissue specificityi

    Ubiquitous. Detected in pancreas, brain, spleen, placenta, prostate, thymus, liver, heart, bone marrow, skeletal muscle, stomach, uterus, testis, kidney, ovary, and colon.2 Publications

    Gene expression databases

    ArrayExpressiQ6NT76.
    BgeeiQ6NT76.
    CleanExiHS_HMBOX1.
    GenevestigatoriQ6NT76.

    Organism-specific databases

    HPAiHPA055855.
    HPA058586.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    DKC1O608322EBI-2549423,EBI-713091
    XRCC6P129562EBI-2549423,EBI-353208

    Protein-protein interaction databases

    BioGridi122750. 4 interactions.
    IntActiQ6NT76. 12 interactions.
    STRINGi9606.ENSP00000287701.

    Structurei

    Secondary structure

    1
    420
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi276 – 28611
    Helixi294 – 30815
    Turni317 – 3193
    Helixi323 – 34321

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2CUFNMR-A268-350[»]
    4J19X-ray2.90A/B233-345[»]
    ProteinModelPortaliQ6NT76.
    SMRiQ6NT76. Positions 151-345.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ6NT76.

    Family & Domainsi

    Sequence similaritiesi

    Contains 1 homeobox DNA-binding domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Homeobox

    Phylogenomic databases

    eggNOGiNOG85561.
    HOVERGENiHBG061176.
    InParanoidiQ6NT76.
    OMAiSYDTSPP.
    OrthoDBiEOG7BGHMM.
    PhylomeDBiQ6NT76.
    TreeFamiTF320327.

    Family and domain databases

    Gene3Di1.10.10.60. 1 hit.
    1.10.260.40. 1 hit.
    InterProiIPR006899. HNF-1_N.
    IPR001356. Homeobox_dom.
    IPR009057. Homeodomain-like.
    IPR010982. Lambda_DNA-bd_dom.
    [Graphical view]
    PfamiPF04814. HNF-1_N. 1 hit.
    PF00046. Homeobox. 1 hit.
    [Graphical view]
    SMARTiSM00389. HOX. 1 hit.
    [Graphical view]
    SUPFAMiSSF46689. SSF46689. 1 hit.
    SSF47413. SSF47413. 1 hit.
    PROSITEiPS50071. HOMEOBOX_2. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6NT76-1) [UniParc]FASTAAdd to Basket

    Also known as: HMBOX1A

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLSSFPVVLL ETMSHYTDEP RFTIEQIDLL QRLRRTGMTK HEILHALETL    50
    DRLDQEHSDK FGRRSSYGGS SYGNSTNNVP ASSSTATAST QTQHSGMSPS 100
    PSNSYDTSPQ PCTTNQNGRE NNERLSTSNG KMSPTRYHAN SMGQRSYSFE 150
    ASEEDLDVDD KVEELMRRDS SVIKEEIKAF LANRRISQAV VAQVTGISQS 200
    RISHWLLQQG SDLSEQKKRA FYRWYQLEKT NPGATLSMRP APIPIEDPEW 250
    RQTPPPVSAT SGTFRLRRGS RFTWRKECLA VMESYFNENQ YPDEAKREEI 300
    ANACNAVIQK PGKKLSDLER VTSLKVYNWF ANRRKEIKRR ANIEAAILES 350
    HGIDVQSPGG HSNSDDVDGN DYSEQDDSTS HSDHQDPISL AVEMAAVNHT 400
    ILALARQGAN EIKTEALDDD 420
    Length:420
    Mass (Da):47,278
    Last modified:July 5, 2004 - v1
    Checksum:iBB47AB7DE3B96996
    GO
    Isoform 2 (identifier: Q6NT76-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         344-344: Missing.
         377-420: DSTSHSDHQDPISLAVEMAAVNHTILALARQGANEIKTEALDDD → TWQVRNGEEEEGRSSEGGREAEKVEEERRI

    Show »
    Length:405
    Mass (Da):45,981
    Checksum:i880A0A8CB7FD20CC
    GO
    Isoform 3 (identifier: Q6NT76-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         344-345: Missing.

    Show »
    Length:418
    Mass (Da):47,078
    Checksum:iC4AD3336D2DDE2A5
    GO
    Isoform 4 (identifier: Q6NT76-4) [UniParc]FASTAAdd to Basket

    Also known as: HMBOX1b

    The sequence of this isoform differs from the canonical sequence as follows:
         284-304: SYFNENQYPDEAKREEIANAC → RNTWSPERRMEENKWKLLSAG
         305-420: Missing.

    Show »
    Length:304
    Mass (Da):34,629
    Checksum:i0EC7468AFDEC2062
    GO
    Isoform 5 (identifier: Q6NT76-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         344-344: Missing.
         375-375: Q → QDTWQVRNGEEEEGRSSEGGREAEK

    Show »
    Length:443
    Mass (Da):49,867
    Checksum:i55213CEAF72622C7
    GO

    Sequence cautioni

    The sequence BAB15099.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti167 – 1671R → G in AAZ81565. 1 PublicationCurated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei284 – 30421SYFNE…IANAC → RNTWSPERRMEENKWKLLSA G in isoform 4. 1 PublicationVSP_038983Add
    BLAST
    Alternative sequencei305 – 420116Missing in isoform 4. 1 PublicationVSP_038984Add
    BLAST
    Alternative sequencei344 – 3452Missing in isoform 3. 1 PublicationVSP_018111
    Alternative sequencei344 – 3441Missing in isoform 2 and isoform 5. 2 PublicationsVSP_018112
    Alternative sequencei375 – 3751Q → QDTWQVRNGEEEEGRSSEGG REAEK in isoform 5. 1 PublicationVSP_038985
    Alternative sequencei377 – 42044DSTSH…ALDDD → TWQVRNGEEEEGRSSEGGRE AEKVEEERRI in isoform 2. 1 PublicationVSP_018113Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY522342 mRNA. Translation: AAS76643.1.
    DQ269478 mRNA. Translation: ABB82947.1.
    AK025269 mRNA. Translation: BAB15099.1. Different initiation.
    AK290683 mRNA. Translation: BAF83372.1.
    AK295320 mRNA. Translation: BAG58297.1.
    CH471080 Genomic DNA. Translation: EAW63496.1.
    CH471080 Genomic DNA. Translation: EAW63499.1.
    CH471080 Genomic DNA. Translation: EAW63500.1.
    BC009259 mRNA. Translation: AAH09259.2.
    BC069242 mRNA. Translation: AAH69242.1.
    DQ153248 mRNA. Translation: AAZ81565.1.
    CCDSiCCDS6071.1. [Q6NT76-1]
    RefSeqiNP_001129198.1. NM_001135726.1. [Q6NT76-1]
    NP_078843.2. NM_024567.3. [Q6NT76-1]
    XP_005273692.1. XM_005273635.1. [Q6NT76-5]
    XP_005273695.1. XM_005273638.1. [Q6NT76-3]
    XP_005273697.1. XM_005273640.1. [Q6NT76-2]
    UniGeneiHs.563560.
    Hs.591836.
    Hs.598881.

    Genome annotation databases

    EnsembliENST00000287701; ENSP00000287701; ENSG00000147421. [Q6NT76-1]
    ENST00000397358; ENSP00000380516; ENSG00000147421. [Q6NT76-1]
    ENST00000403668; ENSP00000384261; ENSG00000147421. [Q6NT76-4]
    ENST00000521516; ENSP00000430238; ENSG00000147421. [Q6NT76-4]
    ENST00000524238; ENSP00000430110; ENSG00000147421. [Q6NT76-5]
    ENST00000558662; ENSP00000453211; ENSG00000147421. [Q6NT76-2]
    GeneIDi79618.
    KEGGihsa:79618.
    UCSCiuc003xhd.4. human. [Q6NT76-1]
    uc003xhg.3. human. [Q6NT76-2]
    uc011lay.2. human. [Q6NT76-5]

    Polymorphism databases

    DMDMi74758116.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY522342 mRNA. Translation: AAS76643.1 .
    DQ269478 mRNA. Translation: ABB82947.1 .
    AK025269 mRNA. Translation: BAB15099.1 . Different initiation.
    AK290683 mRNA. Translation: BAF83372.1 .
    AK295320 mRNA. Translation: BAG58297.1 .
    CH471080 Genomic DNA. Translation: EAW63496.1 .
    CH471080 Genomic DNA. Translation: EAW63499.1 .
    CH471080 Genomic DNA. Translation: EAW63500.1 .
    BC009259 mRNA. Translation: AAH09259.2 .
    BC069242 mRNA. Translation: AAH69242.1 .
    DQ153248 mRNA. Translation: AAZ81565.1 .
    CCDSi CCDS6071.1. [Q6NT76-1 ]
    RefSeqi NP_001129198.1. NM_001135726.1. [Q6NT76-1 ]
    NP_078843.2. NM_024567.3. [Q6NT76-1 ]
    XP_005273692.1. XM_005273635.1. [Q6NT76-5 ]
    XP_005273695.1. XM_005273638.1. [Q6NT76-3 ]
    XP_005273697.1. XM_005273640.1. [Q6NT76-2 ]
    UniGenei Hs.563560.
    Hs.591836.
    Hs.598881.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2CUF NMR - A 268-350 [» ]
    4J19 X-ray 2.90 A/B 233-345 [» ]
    ProteinModelPortali Q6NT76.
    SMRi Q6NT76. Positions 151-345.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 122750. 4 interactions.
    IntActi Q6NT76. 12 interactions.
    STRINGi 9606.ENSP00000287701.

    PTM databases

    PhosphoSitei Q6NT76.

    Polymorphism databases

    DMDMi 74758116.

    Proteomic databases

    MaxQBi Q6NT76.
    PaxDbi Q6NT76.
    PRIDEi Q6NT76.

    Protocols and materials databases

    DNASUi 79618.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000287701 ; ENSP00000287701 ; ENSG00000147421 . [Q6NT76-1 ]
    ENST00000397358 ; ENSP00000380516 ; ENSG00000147421 . [Q6NT76-1 ]
    ENST00000403668 ; ENSP00000384261 ; ENSG00000147421 . [Q6NT76-4 ]
    ENST00000521516 ; ENSP00000430238 ; ENSG00000147421 . [Q6NT76-4 ]
    ENST00000524238 ; ENSP00000430110 ; ENSG00000147421 . [Q6NT76-5 ]
    ENST00000558662 ; ENSP00000453211 ; ENSG00000147421 . [Q6NT76-2 ]
    GeneIDi 79618.
    KEGGi hsa:79618.
    UCSCi uc003xhd.4. human. [Q6NT76-1 ]
    uc003xhg.3. human. [Q6NT76-2 ]
    uc011lay.2. human. [Q6NT76-5 ]

    Organism-specific databases

    CTDi 79618.
    GeneCardsi GC08P028805.
    HGNCi HGNC:26137. HMBOX1.
    HPAi HPA055855.
    HPA058586.
    neXtProti NX_Q6NT76.
    PharmGKBi PA143485490.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG85561.
    HOVERGENi HBG061176.
    InParanoidi Q6NT76.
    OMAi SYDTSPP.
    OrthoDBi EOG7BGHMM.
    PhylomeDBi Q6NT76.
    TreeFami TF320327.

    Miscellaneous databases

    ChiTaRSi HMBOX1. human.
    EvolutionaryTracei Q6NT76.
    GenomeRNAii 79618.
    NextBioi 68685.
    PROi Q6NT76.

    Gene expression databases

    ArrayExpressi Q6NT76.
    Bgeei Q6NT76.
    CleanExi HS_HMBOX1.
    Genevestigatori Q6NT76.

    Family and domain databases

    Gene3Di 1.10.10.60. 1 hit.
    1.10.260.40. 1 hit.
    InterProi IPR006899. HNF-1_N.
    IPR001356. Homeobox_dom.
    IPR009057. Homeodomain-like.
    IPR010982. Lambda_DNA-bd_dom.
    [Graphical view ]
    Pfami PF04814. HNF-1_N. 1 hit.
    PF00046. Homeobox. 1 hit.
    [Graphical view ]
    SMARTi SM00389. HOX. 1 hit.
    [Graphical view ]
    SUPFAMi SSF46689. SSF46689. 1 hit.
    SSF47413. SSF47413. 1 hit.
    PROSITEi PS50071. HOMEOBOX_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Isolation and functional analysis of human HMBOX1, a homeobox containing protein with transcriptional repressor activity."
      Chen S., Saiyin H., Zeng X., Xi J., Liu X., Li X., Yu L.
      Cytogenet. Genome Res. 114:131-136(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
      Tissue: Pancreas.
    2. "Characterization of a novel human HMBOX1 splicing variant lacking the homeodomain and with attenuated transcription repressor activity."
      Zhang M., Chen S., Li Q., Ling Y., Zhang J., Yu L.
      Mol. Biol. Rep. 37:2767-2772(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5).
      Tissue: Caudate nucleus and Colon.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Brain and Ovary.
    6. Zhou G., Nong W., Li H., Ke R., Shen C., Zhong G., Zheng Z., Liang M., Tang Z., Wen S., Lin L., Yang S.
      Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 97-420 (ISOFORM 3).
    7. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    8. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    10. "Solution structure of the homeobox domain of the human hypothetical protein FLJ21616."
      RIKEN structural genomics initiative (RSGI)
      Submitted (NOV-2005) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 268-350.

    Entry informationi

    Entry nameiHMBX1_HUMAN
    AccessioniPrimary (citable) accession number: Q6NT76
    Secondary accession number(s): A4K385
    , A8K3R8, B4DHY5, D3DSU0, Q3Y6P1, Q96GS5, Q9H701
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 2, 2006
    Last sequence update: July 5, 2004
    Last modified: October 1, 2014
    This is version 101 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 8
      Human chromosome 8: entries, gene names and cross-references to MIM
    2. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3