Q6NT76 (HMBX1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 90.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Homeobox-containing protein 1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 420 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Transcription factor. Isoform 1 acts as a transcriptional repressor. Isoform 4 has very low activity as a transcriptional repressor. Ref.1 Ref.2 |
| Subcellular location | Nucleus. Cytoplasm. Note: Predominantly detected in cytoplasm. Ref.1 Ref.2 |
| Tissue specificity | Ubiquitous. Detected in pancreas, brain, spleen, placenta, prostate, thymus, liver, heart, bone marrow, skeletal muscle, stomach, uterus, testis, kidney, ovary, and colon. Ref.1 Ref.2 |
| Sequence similarities | Contains 1 homeobox DNA-binding domain. |
| Sequence caution | The sequence BAB15099.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing |
| Domain | Homeobox |
| Ligand | DNA-binding |
| Molecular function | Repressor |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | negative regulation of transcription, DNA-dependent Inferred from direct assay Ref.2. Source: UniProtKB positive regulation of transcription, DNA-dependentInferred from electronic annotation. Source: InterPro transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | cytoplasm Inferred from direct assay Ref.2. Source: UniProtKB nucleusInferred from direct assay Ref.2. Source: UniProtKB |
| Molecular_function | sequence-specific DNA binding Inferred from electronic annotation. Source: InterPro sequence-specific DNA binding transcription factor activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6NT76-1) Also known as: HMBOX1A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6NT76-2) The sequence of this isoform differs from the canonical sequence as follows: 344-344: Missing. 377-420: DSTSHSDHQDPISLAVEMAAVNHTILALARQGANEIKTEALDDD → TWQVRNGEEEEGRSSEGGREAEKVEEERRI | ||||||
| Isoform 3 (identifier: Q6NT76-3) The sequence of this isoform differs from the canonical sequence as follows: 344-345: Missing. | ||||||
| Isoform 4 (identifier: Q6NT76-4) Also known as: HMBOX1b; The sequence of this isoform differs from the canonical sequence as follows: 284-304: SYFNENQYPDEAKREEIANAC → RNTWSPERRMEENKWKLLSAG 305-420: Missing. | ||||||
| Isoform 5 (identifier: Q6NT76-5) The sequence of this isoform differs from the canonical sequence as follows: 344-344: Missing. 375-375: Q → QDTWQVRNGEEEEGRSSEGGREAEK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||
Molecule processing | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 420 | 420 | Homeobox-containing protein 1 | PRO_0000233287 | |||||||||||||
Regions | |||||||||||||||||
| DNA binding | 267 – 341 | 75 | Homeobox | ||||||||||||||
Natural variations | |||||||||||||||||
| Alternative sequence | 284 – 304 | 21 | SYFNE…IANAC → RNTWSPERRMEENKWKLLSA G in isoform 4. | VSP_038983 | |||||||||||||
| Alternative sequence | 305 – 420 | 116 | Missing in isoform 4. | VSP_038984 | |||||||||||||
| Alternative sequence | 344 – 345 | 2 | Missing in isoform 3. | VSP_018111 | |||||||||||||
| Alternative sequence | 344 | 1 | Missing in isoform 2 and isoform 5. | VSP_018112 | |||||||||||||
| Alternative sequence | 375 | 1 | Q → QDTWQVRNGEEEEGRSSEGG REAEK in isoform 5. | VSP_038985 | |||||||||||||
| Alternative sequence | 377 – 420 | 44 | DSTSH…ALDDD → TWQVRNGEEEEGRSSEGGRE AEKVEEERRI in isoform 2. | VSP_018113 | |||||||||||||
Experimental info | |||||||||||||||||
| Sequence conflict | 167 | 1 | R → G in AAZ81565. Ref.6 | ||||||||||||||
Secondary structure | |||||||||||||||||
Helix Strand Turn | |||||||||||||||||
| Helix | 276 – 288 | 13 | |||||||||||||||
| Helix | 294 – 308 | 15 | |||||||||||||||
| Turn | 317 – 319 | 3 | |||||||||||||||
| Helix | 323 – 342 | 20 | |||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation and functional analysis of human HMBOX1, a homeobox containing protein with transcriptional repressor activity." Chen S., Saiyin H., Zeng X., Xi J., Liu X., Li X., Yu L. Cytogenet. Genome Res. 114:131-136(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Pancreas. |
| [2] | "Characterization of a novel human HMBOX1 splicing variant lacking the homeodomain and with attenuated transcription repressor activity." Zhang M., Chen S., Li Q., Ling Y., Zhang J., Yu L. Mol. Biol. Rep. 37:2767-2772(2010) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5). Tissue: Caudate nucleus and Colon. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Brain and Ovary. |
| [6] | Zhou G., Nong W., Li H., Ke R., Shen C., Zhong G., Zheng Z., Liang M., Tang Z., Wen S., Lin L., Yang S. Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 97-420 (ISOFORM 3). |
| [7] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Leukemic T-cell. |
| [8] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [9] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [10] | "Solution structure of the homeobox domain of the human hypothetical protein FLJ21616." RIKEN structural genomics initiative (RSGI) Submitted (NOV-2005) to the PDB data bank Cited for: STRUCTURE BY NMR OF 268-350. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AY522342 mRNA. Translation: AAS76643.1. DQ269478 mRNA. Translation: ABB82947.1. AK025269 mRNA. Translation: BAB15099.1. Different initiation. AK290683 mRNA. Translation: BAF83372.1. AK295320 mRNA. Translation: BAG58297.1. CH471080 Genomic DNA. Translation: EAW63496.1. CH471080 Genomic DNA. Translation: EAW63499.1. CH471080 Genomic DNA. Translation: EAW63500.1. BC009259 mRNA. Translation: AAH09259.2. BC069242 mRNA. Translation: AAH69242.1. DQ153248 mRNA. Translation: AAZ81565.1. | ||||||||||||
| IPI | IPI00002265. IPI00074230. IPI00748642. IPI00845486. IPI00956180. | ||||||||||||
| RefSeq | NP_001129198.1. NM_001135726.1. NP_078843.2. NM_024567.3. | ||||||||||||
| UniGene | Hs.591836. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q6NT76. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q6NT76. 2 interactions. | ||||||||||||
| STRING | 9606.ENSP00000287701. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q6NT76. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 74758116. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q6NT76. | ||||||||||||
| PRIDE | Q6NT76. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 79618. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000287701; ENSP00000287701; ENSG00000147421. ENST00000397358; ENSP00000380516; ENSG00000147421. ENST00000403668; ENSP00000384261; ENSG00000147421. ENST00000444075; ENSP00000401769; ENSG00000147421. ENST00000521516; ENSP00000430238; ENSG00000147421. ENST00000524238; ENSP00000430110; ENSG00000147421. ENST00000558662; ENSP00000453211; ENSG00000147421. | ||||||||||||
| GeneID | 79618. | ||||||||||||
| KEGG | hsa:79618. | ||||||||||||
| UCSC | uc003xhd.4. human. uc003xhf.3. human. uc003xhg.3. human. uc011lay.2. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 79618. | ||||||||||||
| GeneCards | GC08P028805. | ||||||||||||
| HGNC | HGNC:26137. HMBOX1. | ||||||||||||
| neXtProt | NX_Q6NT76. | ||||||||||||
| PharmGKB | PA143485490. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG85561. | ||||||||||||
| HOVERGEN | HBG061176. | ||||||||||||
| InParanoid | Q6NT76. | ||||||||||||
| OMA | RRTGMTR. | ||||||||||||
| OrthoDB | EOG49ZXPD. | ||||||||||||
| PhylomeDB | Q6NT76. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q6NT76. | ||||||||||||
| Bgee | Q6NT76. | ||||||||||||
| CleanEx | HS_HMBOX1. | ||||||||||||
| Genevestigator | Q6NT76. | ||||||||||||
| GermOnline | ENSG00000147421. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 1.10.10.60. 1 hit. 1.10.260.40. 1 hit. | ||||||||||||
| InterPro | IPR006899. HNF-1_N. IPR001356. Homeodomain. IPR009057. Homeodomain-like. IPR010982. Lambda_DNA-bd_dom. [Graphical view] | ||||||||||||
| Pfam | PF04814. HNF-1_N. 1 hit. PF00046. Homeobox. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00389. HOX. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF46689. Homeodomain_like. 1 hit. SSF47413. Lambda_like_DNA. 1 hit. | ||||||||||||
| PROSITE | PS00027. HOMEOBOX_1. False negative. PS50071. HOMEOBOX_2. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | HMBOX1. human. | ||||||||||||
| EvolutionaryTrace | Q6NT76. | ||||||||||||
| GenomeRNAi | 79618. | ||||||||||||
| NextBio | 68685. | ||||||||||||
Entry information
| Entry name | HMBX1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6NT76 Secondary accession number(s): A4K385 Q9H701 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
