Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Uncharacterized protein KIAA1841

Gene

KIAA1841

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Uncharacterized protein KIAA1841
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:29387. KIAA1841.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA144596415.

Polymorphism and mutation databases

BioMutaiKIAA1841.
DMDMi172046130.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 718718Uncharacterized protein KIAA1841PRO_0000324598Add
BLAST

Proteomic databases

PaxDbiQ6NSI8.
PeptideAtlasiQ6NSI8.
PRIDEiQ6NSI8.

PTM databases

iPTMnetiQ6NSI8.
PhosphoSiteiQ6NSI8.

Expressioni

Gene expression databases

BgeeiENSG00000162929.
CleanExiHS_KIAA1841.
ExpressionAtlasiQ6NSI8. baseline and differential.
GenevisibleiQ6NSI8. HS.

Organism-specific databases

HPAiHPA051240.

Interactioni

Protein-protein interaction databases

BioGridi124129. 5 interactions.
IntActiQ6NSI8. 1 interaction.
STRINGi9606.ENSP00000349154.

Structurei

3D structure databases

ProteinModelPortaliQ6NSI8.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the KIAA1841 family.Curated

Phylogenomic databases

eggNOGiENOG410IF15. Eukaryota.
ENOG410XP9V. LUCA.
GeneTreeiENSGT00390000008178.
HOGENOMiHOG000113180.
HOVERGENiHBG108045.
InParanoidiQ6NSI8.
OMAiQYNPLMA.
OrthoDBiEOG091G02MU.
PhylomeDBiQ6NSI8.
TreeFamiTF324503.

Family and domain databases

InterProiIPR021777. DUF3342.
[Graphical view]
PfamiPF11822. DUF3342. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6NSI8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSRGYSENNN FLNNNNQMVL DMILYPLIGI PQTINWETIA RLVPGLTPKE
60 70 80 90 100
CAKRFDELKS SGSSPVDNQY NSLMAAGESP VETLATYIKS SLLDIHGEFQ
110 120 130 140 150
ETPVGHDAVS KTGRHSIAST RNCSSESENC TTHNGGEMTE ESEGPNMVIH
160 170 180 190 200
VCDEAKNLKE DFTCPRDLLI SEMKYFAEYL SMDAQRWEEV DISVHCDVHI
210 220 230 240 250
FNWLIKYIKR NTKENKDCEM PTLEPGNVIS ILISSEFLKM DSLVEQCIQY
260 270 280 290 300
CHKNMNAIVA TPCNMNCINA NLLTRIADLF SHNEVDDLKD KKDKFKSKLF
310 320 330 340 350
CKKIERLFDP EYLNPDSRSN AATLYRCCLC KKLLTKETER RIPCIPGKIN
360 370 380 390 400
VDRRGNIVYI HIRDKTWDVH EYLNSLFEEL KSWRDVYWRL WGTINWLTCS
410 420 430 440 450
RCYQAFLCIE FSHCQYHSET VVYPTAASSL NTVGTGIYPC CNQKVLRFDP
460 470 480 490 500
TQLTKGCKVR DHMVTLRDQG EGGDLPSCPT ARMLDDLHKY RDVIVVPFSK
510 520 530 540 550
DTVSDVGVGL CDEKGIECDV LLEPNTPWGP KTGELNAFLS LKNWTLQLKQ
560 570 580 590 600
QSLFSEEEEY TTGSEVTEDE VGDEEEVSKK QRKKEKPKKF TRQPKKQVSS
610 620 630 640 650
PCAQRKEKAL EKSASRDVSP FVMSMQKNKW DATRSLRFNQ DAQREDDQRR
660 670 680 690 700
MTEITGHLIK MRLGDLDRVK SKEAKEFAGG IYSRLEAQIK ASVPVSARQS
710
SSEKNTRSKS RFGQGRPA
Length:718
Mass (Da):82,007
Last modified:March 18, 2008 - v2
Checksum:iE57472CE0D86405D
GO
Isoform 2 (identifier: Q6NSI8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     677-718: FAGGIYSRLEAQIKASVPVSARQSSSEKNTRSKSRFGQGRPA → TDKLRPRDGTVSKSNRKSGLSSVLLMTVLLC

Note: No experimental confirmation available.
Show »
Length:707
Mass (Da):80,872
Checksum:iE6FF01DBD1AA6032
GO
Isoform 3 (identifier: Q6NSI8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-146: Missing.

Show »
Length:572
Mass (Da):66,059
Checksum:iDD1FC32F8A33555B
GO
Isoform 4 (identifier: Q6NSI8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     364-379: DKTWDVHEYLNSLFEE → CREDKIHTCIFVYIYI
     380-718: Missing.

Note: No experimental confirmation available.
Show »
Length:379
Mass (Da):43,394
Checksum:iCB3D3E9F7F41F833
GO

Sequence cautioni

The sequence BAB47470 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti207 – 2071Y → F in BAB47470 (PubMed:11347906).Curated
Sequence conflicti215 – 2151N → S in AAH70104 (PubMed:15489334).Curated
Sequence conflicti398 – 3981T → A in AAH70104 (PubMed:15489334).Curated
Sequence conflicti640 – 6401Q → K in AAH39298 (PubMed:15489334).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Isoform 2 (identifier: Q6NSI8-2)
Natural varianti685 – 6851G → S.
Corresponds to variant rs13424173 [ dbSNP | Ensembl ].

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 146146Missing in isoform 3. 1 PublicationVSP_032299Add
BLAST
Alternative sequencei364 – 37916DKTWD…SLFEE → CREDKIHTCIFVYIYI in isoform 4. 1 PublicationVSP_032300Add
BLAST
Alternative sequencei380 – 718339Missing in isoform 4. 1 PublicationVSP_032301Add
BLAST
Alternative sequencei677 – 71842FAGGI…QGRPA → TDKLRPRDGTVSKSNRKSGL SSVLLMTVLLC in isoform 2. 1 PublicationVSP_032302Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK131267 mRNA. Translation: BAD18445.1.
BC039298 mRNA. Translation: AAH39298.1.
BC070104 mRNA. Translation: AAH70104.1.
AB058744 mRNA. Translation: BAB47470.1. Different initiation.
CCDSiCCDS1867.1. [Q6NSI8-2]
CCDS46296.1. [Q6NSI8-1]
RefSeqiNP_001123465.1. NM_001129993.1. [Q6NSI8-1]
NP_115895.2. NM_032506.2. [Q6NSI8-2]
XP_005264663.1. XM_005264606.4. [Q6NSI8-2]
XP_005264664.1. XM_005264607.2. [Q6NSI8-3]
XP_011531428.1. XM_011533126.2. [Q6NSI8-1]
XP_011531429.1. XM_011533127.2. [Q6NSI8-1]
XP_011531430.1. XM_011533128.1. [Q6NSI8-2]
UniGeneiHs.468653.

Genome annotation databases

EnsembliENST00000295031; ENSP00000295031; ENSG00000162929. [Q6NSI8-2]
ENST00000356719; ENSP00000349154; ENSG00000162929. [Q6NSI8-2]
ENST00000402291; ENSP00000385579; ENSG00000162929. [Q6NSI8-1]
ENST00000453873; ENSP00000416795; ENSG00000162929. [Q6NSI8-1]
ENST00000612149; ENSP00000482126; ENSG00000162929. [Q6NSI8-3]
GeneIDi84542.
KEGGihsa:84542.
UCSCiuc002saw.5. human. [Q6NSI8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK131267 mRNA. Translation: BAD18445.1.
BC039298 mRNA. Translation: AAH39298.1.
BC070104 mRNA. Translation: AAH70104.1.
AB058744 mRNA. Translation: BAB47470.1. Different initiation.
CCDSiCCDS1867.1. [Q6NSI8-2]
CCDS46296.1. [Q6NSI8-1]
RefSeqiNP_001123465.1. NM_001129993.1. [Q6NSI8-1]
NP_115895.2. NM_032506.2. [Q6NSI8-2]
XP_005264663.1. XM_005264606.4. [Q6NSI8-2]
XP_005264664.1. XM_005264607.2. [Q6NSI8-3]
XP_011531428.1. XM_011533126.2. [Q6NSI8-1]
XP_011531429.1. XM_011533127.2. [Q6NSI8-1]
XP_011531430.1. XM_011533128.1. [Q6NSI8-2]
UniGeneiHs.468653.

3D structure databases

ProteinModelPortaliQ6NSI8.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124129. 5 interactions.
IntActiQ6NSI8. 1 interaction.
STRINGi9606.ENSP00000349154.

PTM databases

iPTMnetiQ6NSI8.
PhosphoSiteiQ6NSI8.

Polymorphism and mutation databases

BioMutaiKIAA1841.
DMDMi172046130.

Proteomic databases

PaxDbiQ6NSI8.
PeptideAtlasiQ6NSI8.
PRIDEiQ6NSI8.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000295031; ENSP00000295031; ENSG00000162929. [Q6NSI8-2]
ENST00000356719; ENSP00000349154; ENSG00000162929. [Q6NSI8-2]
ENST00000402291; ENSP00000385579; ENSG00000162929. [Q6NSI8-1]
ENST00000453873; ENSP00000416795; ENSG00000162929. [Q6NSI8-1]
ENST00000612149; ENSP00000482126; ENSG00000162929. [Q6NSI8-3]
GeneIDi84542.
KEGGihsa:84542.
UCSCiuc002saw.5. human. [Q6NSI8-1]

Organism-specific databases

CTDi84542.
GeneCardsiKIAA1841.
HGNCiHGNC:29387. KIAA1841.
HPAiHPA051240.
neXtProtiNX_Q6NSI8.
PharmGKBiPA144596415.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IF15. Eukaryota.
ENOG410XP9V. LUCA.
GeneTreeiENSGT00390000008178.
HOGENOMiHOG000113180.
HOVERGENiHBG108045.
InParanoidiQ6NSI8.
OMAiQYNPLMA.
OrthoDBiEOG091G02MU.
PhylomeDBiQ6NSI8.
TreeFamiTF324503.

Miscellaneous databases

ChiTaRSiKIAA1841. human.
GenomeRNAii84542.
PROiQ6NSI8.

Gene expression databases

BgeeiENSG00000162929.
CleanExiHS_KIAA1841.
ExpressionAtlasiQ6NSI8. baseline and differential.
GenevisibleiQ6NSI8. HS.

Family and domain databases

InterProiIPR021777. DUF3342.
[Graphical view]
PfamiPF11822. DUF3342. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiK1841_HUMAN
AccessioniPrimary (citable) accession number: Q6NSI8
Secondary accession number(s): Q49AF0, Q6ZND0, Q96JI6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: March 18, 2008
Last modified: September 7, 2016
This is version 108 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.