Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Calcium-dependent protein kinase 32

Gene

CPK32

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May play a role in signal transduction pathways that involve calcium as a second messenger. Functions as regulator of the calcium-mediated abscisic acid (ABA) signaling pathway. Phosphorylates ABA-responsive transcription factor ABF4 in vitro.1 Publication

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Enzyme regulationi

Activated by calcium. Autophosphorylation may play an important role in the regulation of the kinase activity (By similarity).By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei92 – 921ATPPROSITE-ProRule annotation
Active sitei187 – 1871Proton acceptorPROSITE-ProRule annotation

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi69 – 779ATPPROSITE-ProRule annotation
Calcium bindingi377 – 388124PROSITE-ProRule annotationAdd
BLAST
Calcium bindingi413 – 424121PROSITE-ProRule annotationAdd
BLAST
Calcium bindingi449 – 460122PROSITE-ProRule annotationAdd
BLAST
Calcium bindingi484 – 495123PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

  • abscisic acid-activated signaling pathway Source: TAIR
  • intracellular signal transduction Source: GO_Central
  • peptidyl-serine phosphorylation Source: GO_Central
  • protein autophosphorylation Source: GO_Central
  • response to abscisic acid Source: TAIR
  • response to salt stress Source: TAIR
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Ligandi

ATP-binding, Calcium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciARA:AT3G57530-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Calcium-dependent protein kinase 32 (EC:2.7.11.1)
Gene namesi
Name:CPK32
Ordered Locus Names:At3g57530
ORF Names:T8H10.130
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 3

Organism-specific databases

TAIRiAT3G57530.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: TAIR
  • nucleus Source: TAIR
  • plasma membrane Source: TAIR
  • plasmodesma Source: TAIR
Complete GO annotation...

Keywords - Cellular componenti

Membrane, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methionineiRemovedSequence analysis
Chaini2 – 538537Calcium-dependent protein kinase 32PRO_0000363353Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Lipidationi2 – 21N-myristoyl glycineSequence analysis

Keywords - PTMi

Lipoprotein, Myristate

Proteomic databases

PaxDbiQ6NLQ6.
PRIDEiQ6NLQ6.

PTM databases

iPTMnetiQ6NLQ6.
SwissPalmiQ6NLQ6.

Expressioni

Tissue specificityi

Expressed in embryos and most of the vegetative tissues.1 Publication

Inductioni

Induced by touch, wounding, and darkness exposure. Also induced by high-salt treatment.2 Publications

Gene expression databases

GenevisibleiQ6NLQ6. AT.

Interactioni

Subunit structurei

Interacts with ABF4.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
ABF4Q9M7Q24EBI-1538032,EBI-1237867

GO - Molecular functioni

Protein-protein interaction databases

BioGridi10236. 6 interactions.
IntActiQ6NLQ6. 4 interactions.
STRINGi3702.AT3G57530.1.

Structurei

3D structure databases

ProteinModelPortaliQ6NLQ6.
SMRiQ6NLQ6. Positions 37-533.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini63 – 321259Protein kinasePROSITE-ProRule annotationAdd
BLAST
Domaini364 – 39936EF-hand 1PROSITE-ProRule annotationAdd
BLAST
Domaini400 – 43536EF-hand 2PROSITE-ProRule annotationAdd
BLAST
Domaini436 – 47035EF-hand 3PROSITE-ProRule annotationAdd
BLAST
Domaini471 – 50636EF-hand 4PROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni327 – 35731Autoinhibitory domainBy similarityAdd
BLAST

Domaini

There is 3 contiguous domains conserved in the CDPK subfamily: a kinase domain, an autoinhibitory (junction) domain and a calmodulin-like domain. The autoinhibitory domain (327-357) inactivates kinase activity under calcium-free conditions (By similarity).By similarity

Sequence similaritiesi

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. CDPK subfamily.PROSITE-ProRule annotation
Contains 4 EF-hand domains.PROSITE-ProRule annotation
Contains 1 protein kinase domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0032. Eukaryota.
ENOG410XRMJ. LUCA.
HOGENOMiHOG000233030.
InParanoidiQ6NLQ6.
KOiK13412.
OMAiLGHQIPE.
PhylomeDBiQ6NLQ6.

Family and domain databases

Gene3Di1.10.238.10. 2 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF13499. EF-hand_7. 1 hit.
PF13833. EF-hand_8. 1 hit.
PF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00054. EFh. 4 hits.
SM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS00018. EF_HAND_1. 3 hits.
PS50222. EF_HAND_2. 4 hits.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6NLQ6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGNCCGTAGS LAQNDNKPKK GRKKQNPFSI DYGLHHGGGD GGGRPLKLIV
60 70 80 90 100
LNDPTGREIE SKYTLGRELG RGEFGVTYLC TDKETDDVFA CKSILKKKLR
110 120 130 140 150
TAVDIEDVRR EVEIMRHMPE HPNVVTLKET YEDEHAVHLV MELCEGGELF
160 170 180 190 200
DRIVARGHYT ERAAAAVTKT IMEVVQVCHK HGVMHRDLKP ENFLFGNKKE
210 220 230 240 250
TAPLKAIDFG LSVFFKPGER FNEIVGSPYY MAPEVLKRNY GPEVDIWSAG
260 270 280 290 300
VILYILLCGV PPFWAETEQG VAQAIIRSVL DFRRDPWPKV SENAKDLIRK
310 320 330 340 350
MLDPDQKRRL TAQQVLDHPW LQNAKTAPNV SLGETVRARL KQFTVMNKLK
360 370 380 390 400
KRALRVIAEH LSDEEASGIR EGFQIMDTSQ RGKINIDELK IGLQKLGHAI
410 420 430 440 450
PQDDLQILMD AGDIDRDGYL DCDEFIAISV HLRKMGNDEH LKKAFAFFDQ
460 470 480 490 500
NNNGYIEIEE LREALSDELG TSEEVVDAII RDVDTDKDGR ISYEEFVTMM
510 520 530
KTGTDWRKAS RQYSRERFNS ISLKLMQDAS LQVNGDTR
Length:538
Mass (Da):60,935
Last modified:July 5, 2004 - v1
Checksum:iFAD0C733CB85C810
GO
Isoform 2 (identifier: Q6NLQ6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     357-388: IAEHLSDEEASGIREGFQIMDTSQRGKINIDE → KYILLINYPKMYISSDLKSLTIVSFGLVTLSR
     389-538: Missing.

Note: May be due to intron retention. No experimental confirmation available.
Show »
Length:388
Mass (Da):43,863
Checksum:i7ABA898FD070E9B4
GO

Sequence cautioni

The sequence CAB66110.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei357 – 38832IAEHL…INIDE → KYILLINYPKMYISSDLKSL TIVSFGLVTLSR in isoform 2. 1 PublicationVSP_036298Add
BLAST
Alternative sequencei389 – 538150Missing in isoform 2. 1 PublicationVSP_036299Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL133248 Genomic DNA. Translation: CAB66110.1. Sequence problems.
CP002686 Genomic DNA. Translation: AEE79668.1.
BT011630 mRNA. Translation: AAS47636.1.
BT012274 mRNA. Translation: AAS76761.1.
AK226348 mRNA. Translation: BAE98496.1.
PIRiT46189.
RefSeqiNP_191312.2. NM_115613.3. [Q6NLQ6-1]
UniGeneiAt.43700.

Genome annotation databases

EnsemblPlantsiAT3G57530.1; AT3G57530.1; AT3G57530. [Q6NLQ6-1]
GeneIDi824920.
KEGGiath:AT3G57530.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL133248 Genomic DNA. Translation: CAB66110.1. Sequence problems.
CP002686 Genomic DNA. Translation: AEE79668.1.
BT011630 mRNA. Translation: AAS47636.1.
BT012274 mRNA. Translation: AAS76761.1.
AK226348 mRNA. Translation: BAE98496.1.
PIRiT46189.
RefSeqiNP_191312.2. NM_115613.3. [Q6NLQ6-1]
UniGeneiAt.43700.

3D structure databases

ProteinModelPortaliQ6NLQ6.
SMRiQ6NLQ6. Positions 37-533.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi10236. 6 interactions.
IntActiQ6NLQ6. 4 interactions.
STRINGi3702.AT3G57530.1.

PTM databases

iPTMnetiQ6NLQ6.
SwissPalmiQ6NLQ6.

Proteomic databases

PaxDbiQ6NLQ6.
PRIDEiQ6NLQ6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiAT3G57530.1; AT3G57530.1; AT3G57530. [Q6NLQ6-1]
GeneIDi824920.
KEGGiath:AT3G57530.

Organism-specific databases

TAIRiAT3G57530.

Phylogenomic databases

eggNOGiKOG0032. Eukaryota.
ENOG410XRMJ. LUCA.
HOGENOMiHOG000233030.
InParanoidiQ6NLQ6.
KOiK13412.
OMAiLGHQIPE.
PhylomeDBiQ6NLQ6.

Enzyme and pathway databases

BioCyciARA:AT3G57530-MONOMER.

Miscellaneous databases

PROiQ6NLQ6.

Gene expression databases

GenevisibleiQ6NLQ6. AT.

Family and domain databases

Gene3Di1.10.238.10. 2 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF13499. EF-hand_7. 1 hit.
PF13833. EF-hand_8. 1 hit.
PF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00054. EFh. 4 hits.
SM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS00018. EF_HAND_1. 3 hits.
PS50222. EF_HAND_2. 4 hits.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana."
    Salanoubat M., Lemcke K., Rieger M., Ansorge W., Unseld M., Fartmann B., Valle G., Bloecker H., Perez-Alonso M., Obermaier B., Delseny M., Boutry M., Grivell L.A., Mache R., Puigdomenech P., De Simone V., Choisne N., Artiguenave F.
    , Robert C., Brottier P., Wincker P., Cattolico L., Weissenbach J., Saurin W., Quetier F., Schaefer M., Mueller-Auer S., Gabel C., Fuchs M., Benes V., Wurmbach E., Drzonek H., Erfle H., Jordan N., Bangert S., Wiedelmann R., Kranz H., Voss H., Holland R., Brandt P., Nyakatura G., Vezzi A., D'Angelo M., Pallavicini A., Toppo S., Simionati B., Conrad A., Hornischer K., Kauer G., Loehnert T.-H., Nordsiek G., Reichelt J., Scharfe M., Schoen O., Bargues M., Terol J., Climent J., Navarro P., Collado C., Perez-Perez A., Ottenwaelder B., Duchemin D., Cooke R., Laudie M., Berger-Llauro C., Purnelle B., Masuy D., de Haan M., Maarse A.C., Alcaraz J.-P., Cottet A., Casacuberta E., Monfort A., Argiriou A., Flores M., Liguori R., Vitale D., Mannhaupt G., Haase D., Schoof H., Rudd S., Zaccaria P., Mewes H.-W., Mayer K.F.X., Kaul S., Town C.D., Koo H.L., Tallon L.J., Jenkins J., Rooney T., Rizzo M., Walts A., Utterback T., Fujii C.Y., Shea T.P., Creasy T.H., Haas B., Maiti R., Wu D., Peterson J., Van Aken S., Pai G., Militscher J., Sellers P., Gill J.E., Feldblyum T.V., Preuss D., Lin X., Nierman W.C., Salzberg S.L., White O., Venter J.C., Fraser C.M., Kaneko T., Nakamura Y., Sato S., Kato T., Asamizu E., Sasamoto S., Kimura T., Idesawa K., Kawashima K., Kishida Y., Kiyokawa C., Kohara M., Matsumoto M., Matsuno A., Muraki A., Nakayama S., Nakazaki N., Shinpo S., Takeuchi C., Wada T., Watanabe A., Yamada M., Yasuda M., Tabata S.
    Nature 408:820-822(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: cv. Columbia.
  2. The Arabidopsis Information Resource (TAIR)
    Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
    Cited for: GENOME REANNOTATION.
    Strain: cv. Columbia.
  3. "Arabidopsis ORF clones."
    Cheuk R.F., Chen H., Kim C.J., Shinn P., Ecker J.R.
    Submitted (MAR-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: cv. Columbia.
  4. "Large-scale analysis of RIKEN Arabidopsis full-length (RAFL) cDNAs."
    Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Kamiya A., Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K., Kohara Y., Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K., Akiyama K.
    , Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J., Hayashizaki Y., Shinozaki K.
    Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: cv. Columbia.
  5. "The CDPK superfamily of protein kinases."
    Harmon A.C., Gribskov M., Gubrium E., Harper J.F.
    New Phytol. 151:175-183(2001)
    Cited for: GENE FAMILY, NOMENCLATURE.
  6. "Calcium signaling through protein kinases. The Arabidopsis calcium-dependent protein kinase gene family."
    Cheng S.-H., Willmann M.R., Chen H.-C., Sheen J.
    Plant Physiol. 129:469-485(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: GENE FAMILY, NOMENCLATURE.
  7. "Large-scale analysis of in vivo phosphorylated membrane proteins by immobilized metal ion affinity chromatography and mass spectrometry."
    Nuehse T.S., Stensballe A., Jensen O.N., Peck S.C.
    Mol. Cell. Proteomics 2:1234-1243(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Strain: cv. La-0.
  8. Cited for: GENE FAMILY, NOMENCLATURE.
  9. "Phosphoproteomics of the Arabidopsis plasma membrane and a new phosphorylation site database."
    Nuehse T.S., Stensballe A., Jensen O.N., Peck S.C.
    Plant Cell 16:2394-2405(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  10. "Arabidopsis calcium-dependent protein kinase AtCPK32 interacts with ABF4, a transcriptional regulator of abscisic acid-responsive gene expression, and modulates its activity."
    Choi H.-I., Park H.-J., Park J.H., Kim S., Im M.-Y., Seo H.-H., Kim Y.-W., Hwang I., Kim S.Y.
    Plant Physiol. 139:1750-1761(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION, INDUCTION, INTERACTION WITH ABF4.
  11. "Use of differential display for the identification of touch-induced genes from an ethylene-insensitive Arabidopsis mutant and partial characterization of these genes."
    Chotikacharoensuk T., Arteca R.N., Arteca J.M.
    J. Plant Physiol. 163:1305-1320(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION.

Entry informationi

Entry nameiCDPKW_ARATH
AccessioniPrimary (citable) accession number: Q6NLQ6
Secondary accession number(s): Q0WWK2, Q9SCM0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 10, 2009
Last sequence update: July 5, 2004
Last modified: May 11, 2016
This is version 111 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.