Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q6N063 (OGFD2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 79. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
2-oxoglutarate and iron-dependent oxygenase domain-containing protein 2

EC=1.14.11.-
Gene names
Name:OGFOD2
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length350 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Cofactor

Binds 1 Fe2+ ion per subunit By similarity.

Ascorbate By similarity.

Sequence similarities

Belongs to the OGFOD2 family.

Contains 1 Fe2OG dioxygenase domain.

Sequence caution

The sequence CAE45849.1 differs from that shown. Reason: Erroneous translation. Wrong choice of frame.

The sequence CAE45849.1 differs from that shown. Reason: Frameshift at position 104.

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q6N063-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q6N063-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: Missing.
     61-62: LA → MV
Isoform 3 (identifier: Q6N063-3)

The sequence of this isoform differs from the canonical sequence as follows:
     64-64: L → WPQEDGRPHLVTTLCHPSLSRRWSGGSGWGRSQQLGKPSSRVPTTRHGLRSTTHCRMQLWPPSSWP
     65-350: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: Q6N063-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-164: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 3503502-oxoglutarate and iron-dependent oxygenase domain-containing protein 2
PRO_0000288978

Regions

Domain215 – 30995Fe2OG dioxygenase

Sites

Metal binding2351Iron By similarity
Metal binding2371Iron By similarity
Metal binding2901Iron By similarity
Binding site30012-oxoglutarate Potential

Natural variations

Alternative sequence1 – 164164Missing in isoform 4.
VSP_025855
Alternative sequence1 – 6060Missing in isoform 2.
VSP_025856
Alternative sequence61 – 622LA → MV in isoform 2.
VSP_025857
Alternative sequence641L → WPQEDGRPHLVTTLCHPSLS RRWSGGSGWGRSQQLGKPSS RVPTTRHGLRSTTHCRMQLW PPSSWP in isoform 3.
VSP_025858
Alternative sequence65 – 350286Missing in isoform 3.
VSP_025859

Experimental info

Sequence conflict2441N → S in CAE45807. Ref.2
Sequence conflict3111A → T in AAH98119. Ref.5
Sequence conflict3111A → T in AAI01941. Ref.5

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 29, 2007. Version 2.
Checksum: 651D0F07A32EBB66

FASTA35038,996
        10         20         30         40         50         60 
MATVGAPRHF CRCACFCTDN LYVARYGLHV RFRGEQQLRR DYGPILRSRG CVSAKDFQQL 

        70         80         90        100        110        120 
LAELEQEVER RQRLGQESAA RKALIASSYH PARPEVYDSL QDAALAPEFL AVTEYSVSPD 

       130        140        150        160        170        180 
ADLKGLLQRL ETVSEEKRIY RVPVFTAPFC QALLEELEHF EQSDMPKGRP NTMNNYGVLL 

       190        200        210        220        230        240 
HELGLDEPLM TPLRERFLQP LMALLYPDCG GGRLDSHRAF VVKYAPGQDL ELGCHYDNAE 

       250        260        270        280        290        300 
LTLNVALGKV FTGGALYFGG LFQAPTALTE PLEVEHVVGQ GVLHRGGQLH GARPLGTGER 

       310        320        330        340        350 
WNLVVWLRAS AVRNSLCPMC CREPDLVDDE GFGDGFTREE PATVDVCALT 

« Hide

Isoform 2 [UniParc].

Checksum: 5B5A06579ED4EDAD
Show »

FASTA29032,121
Isoform 3 [UniParc].

Checksum: C94B1F86CA7B53CD
Show »

FASTA12914,735
Isoform 4 [UniParc].

Checksum: 5D2FAFD3CEB790F8
Show »

FASTA18620,288

References

[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Brain and Placenta.
[2]"Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
[3]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
Tissue: Colon endothelium and Fetal liver.
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK023553 mRNA. Translation: BAB14610.1.
AK094820 mRNA. Translation: BAG52936.1.
CR457316 mRNA. Translation: CAG33597.1.
BX640675 mRNA. Translation: CAE45807.1.
BX640734 mRNA. Translation: CAE45849.1. Sequence problems.
CH471054 Genomic DNA. Translation: EAW98364.1.
BC098119 mRNA. Translation: AAH98119.1.
BC098293 mRNA. Translation: AAH98293.1.
BC101940 mRNA. Translation: AAI01941.1.
BC105637 mRNA. Translation: AAI05638.1.
RefSeqNP_078899.1. NM_024623.1.
UniGeneHs.524817.

3D structure databases

ProteinModelPortalQ6N063.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid122801. 3 interactions.
IntActQ6N063. 2 interactions.
MINTMINT-1407968.
STRING9606.ENSP00000380544.

Chemistry

DrugBankDB00126. Vitamin C.

PTM databases

PhosphoSiteQ6N063.

Polymorphism databases

DMDM156633666.

Proteomic databases

PaxDbQ6N063.
PRIDEQ6N063.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000228922; ENSP00000228922; ENSG00000111325. [Q6N063-1]
ENST00000397389; ENSP00000380544; ENSG00000111325. [Q6N063-2]
ENST00000454694; ENSP00000394175; ENSG00000111325. [Q6N063-4]
ENST00000536150; ENSP00000438327; ENSG00000111325. [Q6N063-4]
ENST00000538628; ENSP00000444608; ENSG00000111325. [Q6N063-4]
ENST00000538755; ENSP00000442817; ENSG00000111325. [Q6N063-4]
ENST00000540324; ENSP00000439667; ENSG00000111325. [Q6N063-3]
ENST00000545317; ENSP00000438192; ENSG00000111325. [Q6N063-4]
ENST00000545612; ENSP00000444436; ENSG00000111325. [Q6N063-4]
GeneID79676.
KEGGhsa:79676.
UCSCuc001uds.1. human. [Q6N063-1]
uc001udz.1. human. [Q6N063-2]

Organism-specific databases

CTD79676.
GeneCardsGC12P123459.
H-InvDBHIX0079485.
HGNCHGNC:25823. OGFOD2.
HPAHPA039448.
HPA040306.
neXtProtNX_Q6N063.
PharmGKBPA143485569.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG248193.
HOGENOMHOG000008117.
HOVERGENHBG108212.
InParanoidQ6N063.
OMALCPMCCR.
OrthoDBEOG776SQB.
PhylomeDBQ6N063.
TreeFamTF329650.

Gene expression databases

BgeeQ6N063.
CleanExHS_OGFOD2.
GenevestigatorQ6N063.

Family and domain databases

InterProIPR005123. Oxoglu/Fe-dep_dioxygenase.
IPR006620. Pro_4_hyd_alph.
[Graphical view]
SMARTSM00702. P4Hc. 1 hit.
[Graphical view]
PROSITEPS51471. FE2OG_OXY. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSOGFOD2. human.
GenomeRNAi79676.
NextBio68918.
PROQ6N063.

Entry information

Entry nameOGFD2_HUMAN
AccessionPrimary (citable) accession number: Q6N063
Secondary accession number(s): B3KT24 expand/collapse secondary AC list , Q4KN13, Q6N023, Q9H8K6
Entry history
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: May 29, 2007
Last modified: April 16, 2014
This is version 79 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human chromosome 12

Human chromosome 12: entries, gene names and cross-references to MIM