Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6N063

- OGFD2_HUMAN

UniProt

Q6N063 - OGFD2_HUMAN

Protein

2-oxoglutarate and iron-dependent oxygenase domain-containing protein 2

Gene

OGFOD2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 82 (01 Oct 2014)
      Sequence version 2 (29 May 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Cofactori

    Binds 1 Fe2+ ion per subunit.PROSITE-ProRule annotation
    Ascorbate.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi235 – 2351IronPROSITE-ProRule annotation
    Metal bindingi237 – 2371IronPROSITE-ProRule annotation
    Metal bindingi290 – 2901IronPROSITE-ProRule annotation
    Binding sitei300 – 30012-oxoglutaratePROSITE-ProRule annotation

    GO - Molecular functioni

    1. iron ion binding Source: InterPro
    2. L-ascorbic acid binding Source: UniProtKB-KW
    3. oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors Source: InterPro

    Keywords - Molecular functioni

    Dioxygenase, Oxidoreductase

    Keywords - Ligandi

    Iron, Metal-binding, Vitamin C

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    2-oxoglutarate and iron-dependent oxygenase domain-containing protein 2 (EC:1.14.11.-)
    Gene namesi
    Name:OGFOD2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:25823. OGFOD2.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA143485569.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 3503502-oxoglutarate and iron-dependent oxygenase domain-containing protein 2PRO_0000288978Add
    BLAST

    Proteomic databases

    MaxQBiQ6N063.
    PaxDbiQ6N063.
    PRIDEiQ6N063.

    PTM databases

    PhosphoSiteiQ6N063.

    Expressioni

    Gene expression databases

    BgeeiQ6N063.
    CleanExiHS_OGFOD2.
    GenevestigatoriQ6N063.

    Organism-specific databases

    HPAiHPA039448.
    HPA040306.

    Interactioni

    Protein-protein interaction databases

    BioGridi122801. 3 interactions.
    IntActiQ6N063. 2 interactions.
    MINTiMINT-1407968.
    STRINGi9606.ENSP00000380544.

    Structurei

    3D structure databases

    ProteinModelPortaliQ6N063.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini215 – 30995Fe2OG dioxygenasePROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the OGFOD2 family.Curated
    Contains 1 Fe2OG dioxygenase domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG248193.
    HOGENOMiHOG000008117.
    HOVERGENiHBG108212.
    InParanoidiQ6N063.
    OMAiLCPMCCR.
    OrthoDBiEOG776SQB.
    PhylomeDBiQ6N063.
    TreeFamiTF329650.

    Family and domain databases

    InterProiIPR005123. Oxoglu/Fe-dep_dioxygenase.
    IPR006620. Pro_4_hyd_alph.
    [Graphical view]
    SMARTiSM00702. P4Hc. 1 hit.
    [Graphical view]
    PROSITEiPS51471. FE2OG_OXY. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6N063-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MATVGAPRHF CRCACFCTDN LYVARYGLHV RFRGEQQLRR DYGPILRSRG    50
    CVSAKDFQQL LAELEQEVER RQRLGQESAA RKALIASSYH PARPEVYDSL 100
    QDAALAPEFL AVTEYSVSPD ADLKGLLQRL ETVSEEKRIY RVPVFTAPFC 150
    QALLEELEHF EQSDMPKGRP NTMNNYGVLL HELGLDEPLM TPLRERFLQP 200
    LMALLYPDCG GGRLDSHRAF VVKYAPGQDL ELGCHYDNAE LTLNVALGKV 250
    FTGGALYFGG LFQAPTALTE PLEVEHVVGQ GVLHRGGQLH GARPLGTGER 300
    WNLVVWLRAS AVRNSLCPMC CREPDLVDDE GFGDGFTREE PATVDVCALT 350
    Length:350
    Mass (Da):38,996
    Last modified:May 29, 2007 - v2
    Checksum:i651D0F07A32EBB66
    GO
    Isoform 2 (identifier: Q6N063-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-60: Missing.
         61-62: LA → MV

    Show »
    Length:290
    Mass (Da):32,121
    Checksum:i5B5A06579ED4EDAD
    GO
    Isoform 3 (identifier: Q6N063-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         64-64: L → WPQEDGRPHLVTTLCHPSLSRRWSGGSGWGRSQQLGKPSSRVPTTRHGLRSTTHCRMQLWPPSSWP
         65-350: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:129
    Mass (Da):14,735
    Checksum:iC94B1F86CA7B53CD
    GO
    Isoform 4 (identifier: Q6N063-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-164: Missing.

    Show »
    Length:186
    Mass (Da):20,288
    Checksum:i5D2FAFD3CEB790F8
    GO

    Sequence cautioni

    The sequence CAE45849.1 differs from that shown. Reason: Frameshift at position 104.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti244 – 2441N → S in CAE45807. 1 PublicationCurated
    Sequence conflicti311 – 3111A → T in AAH98119. (PubMed:15489334)Curated
    Sequence conflicti311 – 3111A → T in AAI01941. (PubMed:15489334)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 164164Missing in isoform 4. 1 PublicationVSP_025855Add
    BLAST
    Alternative sequencei1 – 6060Missing in isoform 2. 2 PublicationsVSP_025856Add
    BLAST
    Alternative sequencei61 – 622LA → MV in isoform 2. 2 PublicationsVSP_025857
    Alternative sequencei64 – 641L → WPQEDGRPHLVTTLCHPSLS RRWSGGSGWGRSQQLGKPSS RVPTTRHGLRSTTHCRMQLW PPSSWP in isoform 3. 1 PublicationVSP_025858
    Alternative sequencei65 – 350286Missing in isoform 3. 1 PublicationVSP_025859Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK023553 mRNA. Translation: BAB14610.1.
    AK094820 mRNA. Translation: BAG52936.1.
    CR457316 mRNA. Translation: CAG33597.1.
    BX640675 mRNA. Translation: CAE45807.1.
    BX640734 mRNA. Translation: CAE45849.1. Sequence problems.
    CH471054 Genomic DNA. Translation: EAW98364.1.
    BC098119 mRNA. Translation: AAH98119.1.
    BC098293 mRNA. Translation: AAH98293.1.
    BC101940 mRNA. Translation: AAI01941.1.
    BC105637 mRNA. Translation: AAI05638.1.
    CCDSiCCDS41855.1. [Q6N063-2]
    RefSeqiNP_078899.1. NM_024623.1. [Q6N063-2]
    UniGeneiHs.524817.

    Genome annotation databases

    EnsembliENST00000228922; ENSP00000228922; ENSG00000111325. [Q6N063-1]
    ENST00000397389; ENSP00000380544; ENSG00000111325. [Q6N063-2]
    ENST00000454694; ENSP00000394175; ENSG00000111325. [Q6N063-4]
    ENST00000536150; ENSP00000438327; ENSG00000111325. [Q6N063-4]
    ENST00000538628; ENSP00000444608; ENSG00000111325. [Q6N063-4]
    ENST00000538755; ENSP00000442817; ENSG00000111325. [Q6N063-4]
    ENST00000540324; ENSP00000439667; ENSG00000111325. [Q6N063-3]
    ENST00000545317; ENSP00000438192; ENSG00000111325. [Q6N063-4]
    ENST00000545612; ENSP00000444436; ENSG00000111325. [Q6N063-4]
    GeneIDi79676.
    KEGGihsa:79676.
    UCSCiuc001uds.1. human. [Q6N063-1]
    uc001udz.1. human. [Q6N063-2]

    Polymorphism databases

    DMDMi156633666.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK023553 mRNA. Translation: BAB14610.1 .
    AK094820 mRNA. Translation: BAG52936.1 .
    CR457316 mRNA. Translation: CAG33597.1 .
    BX640675 mRNA. Translation: CAE45807.1 .
    BX640734 mRNA. Translation: CAE45849.1 . Sequence problems.
    CH471054 Genomic DNA. Translation: EAW98364.1 .
    BC098119 mRNA. Translation: AAH98119.1 .
    BC098293 mRNA. Translation: AAH98293.1 .
    BC101940 mRNA. Translation: AAI01941.1 .
    BC105637 mRNA. Translation: AAI05638.1 .
    CCDSi CCDS41855.1. [Q6N063-2 ]
    RefSeqi NP_078899.1. NM_024623.1. [Q6N063-2 ]
    UniGenei Hs.524817.

    3D structure databases

    ProteinModelPortali Q6N063.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 122801. 3 interactions.
    IntActi Q6N063. 2 interactions.
    MINTi MINT-1407968.
    STRINGi 9606.ENSP00000380544.

    Chemistry

    DrugBanki DB00126. Vitamin C.

    PTM databases

    PhosphoSitei Q6N063.

    Polymorphism databases

    DMDMi 156633666.

    Proteomic databases

    MaxQBi Q6N063.
    PaxDbi Q6N063.
    PRIDEi Q6N063.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000228922 ; ENSP00000228922 ; ENSG00000111325 . [Q6N063-1 ]
    ENST00000397389 ; ENSP00000380544 ; ENSG00000111325 . [Q6N063-2 ]
    ENST00000454694 ; ENSP00000394175 ; ENSG00000111325 . [Q6N063-4 ]
    ENST00000536150 ; ENSP00000438327 ; ENSG00000111325 . [Q6N063-4 ]
    ENST00000538628 ; ENSP00000444608 ; ENSG00000111325 . [Q6N063-4 ]
    ENST00000538755 ; ENSP00000442817 ; ENSG00000111325 . [Q6N063-4 ]
    ENST00000540324 ; ENSP00000439667 ; ENSG00000111325 . [Q6N063-3 ]
    ENST00000545317 ; ENSP00000438192 ; ENSG00000111325 . [Q6N063-4 ]
    ENST00000545612 ; ENSP00000444436 ; ENSG00000111325 . [Q6N063-4 ]
    GeneIDi 79676.
    KEGGi hsa:79676.
    UCSCi uc001uds.1. human. [Q6N063-1 ]
    uc001udz.1. human. [Q6N063-2 ]

    Organism-specific databases

    CTDi 79676.
    GeneCardsi GC12P123459.
    H-InvDB HIX0079485.
    HGNCi HGNC:25823. OGFOD2.
    HPAi HPA039448.
    HPA040306.
    neXtProti NX_Q6N063.
    PharmGKBi PA143485569.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG248193.
    HOGENOMi HOG000008117.
    HOVERGENi HBG108212.
    InParanoidi Q6N063.
    OMAi LCPMCCR.
    OrthoDBi EOG776SQB.
    PhylomeDBi Q6N063.
    TreeFami TF329650.

    Miscellaneous databases

    ChiTaRSi OGFOD2. human.
    GenomeRNAii 79676.
    NextBioi 68918.
    PROi Q6N063.

    Gene expression databases

    Bgeei Q6N063.
    CleanExi HS_OGFOD2.
    Genevestigatori Q6N063.

    Family and domain databases

    InterProi IPR005123. Oxoglu/Fe-dep_dioxygenase.
    IPR006620. Pro_4_hyd_alph.
    [Graphical view ]
    SMARTi SM00702. P4Hc. 1 hit.
    [Graphical view ]
    PROSITEi PS51471. FE2OG_OXY. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Brain and Placenta.
    2. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
      Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
      Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
      Tissue: Colon endothelium and Fetal liver.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).

    Entry informationi

    Entry nameiOGFD2_HUMAN
    AccessioniPrimary (citable) accession number: Q6N063
    Secondary accession number(s): B3KT24
    , Q4KN13, Q6N023, Q9H8K6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 29, 2007
    Last sequence update: May 29, 2007
    Last modified: October 1, 2014
    This is version 82 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3