Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

2-oxoglutarate and iron-dependent oxygenase domain-containing protein 2

Gene

OGFOD2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Cofactori

Protein has several cofactor binding sites:
  • Fe2+PROSITE-ProRule annotationNote: Binds 1 Fe2+ ion per subunit.PROSITE-ProRule annotation
  • L-ascorbateBy similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi235IronPROSITE-ProRule annotation1
Metal bindingi237IronPROSITE-ProRule annotation1
Metal bindingi290IronPROSITE-ProRule annotation1
Binding sitei3002-oxoglutaratePROSITE-ProRule annotation1

GO - Molecular functioni

Keywordsi

Molecular functionDioxygenase, Oxidoreductase
LigandIron, Metal-binding, Vitamin C

Names & Taxonomyi

Protein namesi
Recommended name:
2-oxoglutarate and iron-dependent oxygenase domain-containing protein 2 (EC:1.14.11.-)
Gene namesi
Name:OGFOD2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

EuPathDBiHostDB:ENSG00000111325.16
HGNCiHGNC:25823 OGFOD2
neXtProtiNX_Q6N063

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000111325
PharmGKBiPA143485569

Chemistry databases

DrugBankiDB00126 Vitamin C

Polymorphism and mutation databases

BioMutaiOGFOD2
DMDMi156633666

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002889781 – 3502-oxoglutarate and iron-dependent oxygenase domain-containing protein 2Add BLAST350

Proteomic databases

EPDiQ6N063
MaxQBiQ6N063
PaxDbiQ6N063
PeptideAtlasiQ6N063
PRIDEiQ6N063
ProteomicsDBi66608
66609 [Q6N063-2]
66610 [Q6N063-3]
66611 [Q6N063-4]

PTM databases

iPTMnetiQ6N063
PhosphoSitePlusiQ6N063

Expressioni

Gene expression databases

BgeeiENSG00000111325
CleanExiHS_OGFOD2
ExpressionAtlasiQ6N063 baseline and differential
GenevisibleiQ6N063 HS

Organism-specific databases

HPAiHPA039448
HPA040306

Interactioni

Protein-protein interaction databases

BioGridi122801, 3 interactors
IntActiQ6N063, 2 interactors
STRINGi9606.ENSP00000380544

Structurei

3D structure databases

ProteinModelPortaliQ6N063
SMRiQ6N063
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini215 – 309Fe2OG dioxygenasePROSITE-ProRule annotationAdd BLAST95

Sequence similaritiesi

Belongs to the OGFOD2 family.Curated

Phylogenomic databases

eggNOGiKOG1971 Eukaryota
ENOG410Y4QU LUCA
GeneTreeiENSGT00390000016796
HOGENOMiHOG000008117
HOVERGENiHBG108212
InParanoidiQ6N063
OMAiLCPMCCR
OrthoDBiEOG091G0KW9
PhylomeDBiQ6N063
TreeFamiTF329650

Family and domain databases

InterProiView protein in InterPro
IPR005123 Oxoglu/Fe-dep_dioxygenase
IPR006620 Pro_4_hyd_alph
SMARTiView protein in SMART
SM00702 P4Hc, 1 hit
PROSITEiView protein in PROSITE
PS51471 FE2OG_OXY, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6N063-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATVGAPRHF CRCACFCTDN LYVARYGLHV RFRGEQQLRR DYGPILRSRG
60 70 80 90 100
CVSAKDFQQL LAELEQEVER RQRLGQESAA RKALIASSYH PARPEVYDSL
110 120 130 140 150
QDAALAPEFL AVTEYSVSPD ADLKGLLQRL ETVSEEKRIY RVPVFTAPFC
160 170 180 190 200
QALLEELEHF EQSDMPKGRP NTMNNYGVLL HELGLDEPLM TPLRERFLQP
210 220 230 240 250
LMALLYPDCG GGRLDSHRAF VVKYAPGQDL ELGCHYDNAE LTLNVALGKV
260 270 280 290 300
FTGGALYFGG LFQAPTALTE PLEVEHVVGQ GVLHRGGQLH GARPLGTGER
310 320 330 340 350
WNLVVWLRAS AVRNSLCPMC CREPDLVDDE GFGDGFTREE PATVDVCALT
Length:350
Mass (Da):38,996
Last modified:May 29, 2007 - v2
Checksum:i651D0F07A32EBB66
GO
Isoform 2 (identifier: Q6N063-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: Missing.
     61-62: LA → MV

Show »
Length:290
Mass (Da):32,121
Checksum:i5B5A06579ED4EDAD
GO
Isoform 3 (identifier: Q6N063-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     64-64: L → WPQEDGRPHLVTTLCHPSLSRRWSGGSGWGRSQQLGKPSSRVPTTRHGLRSTTHCRMQLWPPSSWP
     65-350: Missing.

Note: No experimental confirmation available.
Show »
Length:129
Mass (Da):14,735
Checksum:iC94B1F86CA7B53CD
GO
Isoform 4 (identifier: Q6N063-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-164: Missing.

Show »
Length:186
Mass (Da):20,288
Checksum:i5D2FAFD3CEB790F8
GO

Sequence cautioni

The sequence CAE45849 differs from that shown. Reason: Frameshift at position 104.Curated
The sequence CAE45849 differs from that shown. Reason: Erroneous translation. Wrong choice of frame.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti244N → S in CAE45807 (Ref. 2) Curated1
Sequence conflicti311A → T in AAH98119 (PubMed:15489334).Curated1
Sequence conflicti311A → T in AAI01941 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0258551 – 164Missing in isoform 4. 1 PublicationAdd BLAST164
Alternative sequenceiVSP_0258561 – 60Missing in isoform 2. 2 PublicationsAdd BLAST60
Alternative sequenceiVSP_02585761 – 62LA → MV in isoform 2. 2 Publications2
Alternative sequenceiVSP_02585864L → WPQEDGRPHLVTTLCHPSLS RRWSGGSGWGRSQQLGKPSS RVPTTRHGLRSTTHCRMQLW PPSSWP in isoform 3. 1 Publication1
Alternative sequenceiVSP_02585965 – 350Missing in isoform 3. 1 PublicationAdd BLAST286

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK023553 mRNA Translation: BAB14610.1
AK094820 mRNA Translation: BAG52936.1
CR457316 mRNA Translation: CAG33597.1
BX640675 mRNA Translation: CAE45807.1
BX640734 mRNA Translation: CAE45849.1 Sequence problems.
CH471054 Genomic DNA Translation: EAW98364.1
BC098119 mRNA Translation: AAH98119.1
BC098293 mRNA Translation: AAH98293.1
BC101940 mRNA Translation: AAI01941.1
BC105637 mRNA Translation: AAI05638.1
CCDSiCCDS41855.1 [Q6N063-2]
CCDS76617.1 [Q6N063-1]
CCDS76618.1 [Q6N063-4]
RefSeqiNP_001291762.1, NM_001304833.1 [Q6N063-1]
NP_001291763.1, NM_001304834.1 [Q6N063-4]
NP_001291764.1, NM_001304835.1 [Q6N063-4]
NP_001291765.1, NM_001304836.1 [Q6N063-4]
NP_001291766.1, NM_001304837.1 [Q6N063-4]
NP_001291767.1, NM_001304838.1 [Q6N063-4]
NP_078899.1, NM_024623.2 [Q6N063-2]
UniGeneiHs.524817

Genome annotation databases

EnsembliENST00000228922; ENSP00000228922; ENSG00000111325 [Q6N063-1]
ENST00000397389; ENSP00000380544; ENSG00000111325 [Q6N063-2]
ENST00000454694; ENSP00000394175; ENSG00000111325 [Q6N063-4]
ENST00000536150; ENSP00000438327; ENSG00000111325 [Q6N063-4]
ENST00000538628; ENSP00000444608; ENSG00000111325 [Q6N063-4]
ENST00000538755; ENSP00000442817; ENSG00000111325 [Q6N063-4]
ENST00000540324; ENSP00000439667; ENSG00000111325 [Q6N063-3]
ENST00000545317; ENSP00000438192; ENSG00000111325 [Q6N063-4]
ENST00000545612; ENSP00000444436; ENSG00000111325 [Q6N063-4]
GeneIDi79676
KEGGihsa:79676
UCSCiuc001uds.2 human [Q6N063-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiOGFD2_HUMAN
AccessioniPrimary (citable) accession number: Q6N063
Secondary accession number(s): B3KT24
, Q4KN13, Q6N023, Q9H8K6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: May 29, 2007
Last modified: June 20, 2018
This is version 106 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health