Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6N063

- OGFD2_HUMAN

UniProt

Q6N063 - OGFD2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

2-oxoglutarate and iron-dependent oxygenase domain-containing protein 2

Gene

OGFOD2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli

Functioni

Cofactori

Binds 1 Fe2+ ion per subunit.PROSITE-ProRule annotation
Ascorbate.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi235 – 2351IronPROSITE-ProRule annotation
Metal bindingi237 – 2371IronPROSITE-ProRule annotation
Metal bindingi290 – 2901IronPROSITE-ProRule annotation
Binding sitei300 – 30012-oxoglutaratePROSITE-ProRule annotation

GO - Molecular functioni

  1. iron ion binding Source: InterPro
  2. L-ascorbic acid binding Source: UniProtKB-KW
  3. oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Dioxygenase, Oxidoreductase

Keywords - Ligandi

Iron, Metal-binding, Vitamin C

Names & Taxonomyi

Protein namesi
Recommended name:
2-oxoglutarate and iron-dependent oxygenase domain-containing protein 2 (EC:1.14.11.-)
Gene namesi
Name:OGFOD2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:25823. OGFOD2.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA143485569.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 3503502-oxoglutarate and iron-dependent oxygenase domain-containing protein 2PRO_0000288978Add
BLAST

Proteomic databases

MaxQBiQ6N063.
PaxDbiQ6N063.
PRIDEiQ6N063.

PTM databases

PhosphoSiteiQ6N063.

Expressioni

Gene expression databases

BgeeiQ6N063.
CleanExiHS_OGFOD2.
ExpressionAtlasiQ6N063. baseline.
GenevestigatoriQ6N063.

Organism-specific databases

HPAiHPA039448.
HPA040306.

Interactioni

Protein-protein interaction databases

BioGridi122801. 3 interactions.
IntActiQ6N063. 2 interactions.
MINTiMINT-1407968.
STRINGi9606.ENSP00000380544.

Structurei

3D structure databases

ProteinModelPortaliQ6N063.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini215 – 30995Fe2OG dioxygenasePROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the OGFOD2 family.Curated
Contains 1 Fe2OG dioxygenase domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG248193.
GeneTreeiENSGT00390000016796.
HOGENOMiHOG000008117.
HOVERGENiHBG108212.
InParanoidiQ6N063.
OMAiLCPMCCR.
OrthoDBiEOG776SQB.
PhylomeDBiQ6N063.
TreeFamiTF329650.

Family and domain databases

InterProiIPR005123. Oxoglu/Fe-dep_dioxygenase.
IPR006620. Pro_4_hyd_alph.
[Graphical view]
SMARTiSM00702. P4Hc. 1 hit.
[Graphical view]
PROSITEiPS51471. FE2OG_OXY. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6N063-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATVGAPRHF CRCACFCTDN LYVARYGLHV RFRGEQQLRR DYGPILRSRG
60 70 80 90 100
CVSAKDFQQL LAELEQEVER RQRLGQESAA RKALIASSYH PARPEVYDSL
110 120 130 140 150
QDAALAPEFL AVTEYSVSPD ADLKGLLQRL ETVSEEKRIY RVPVFTAPFC
160 170 180 190 200
QALLEELEHF EQSDMPKGRP NTMNNYGVLL HELGLDEPLM TPLRERFLQP
210 220 230 240 250
LMALLYPDCG GGRLDSHRAF VVKYAPGQDL ELGCHYDNAE LTLNVALGKV
260 270 280 290 300
FTGGALYFGG LFQAPTALTE PLEVEHVVGQ GVLHRGGQLH GARPLGTGER
310 320 330 340 350
WNLVVWLRAS AVRNSLCPMC CREPDLVDDE GFGDGFTREE PATVDVCALT
Length:350
Mass (Da):38,996
Last modified:May 29, 2007 - v2
Checksum:i651D0F07A32EBB66
GO
Isoform 2 (identifier: Q6N063-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: Missing.
     61-62: LA → MV

Show »
Length:290
Mass (Da):32,121
Checksum:i5B5A06579ED4EDAD
GO
Isoform 3 (identifier: Q6N063-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     64-64: L → WPQEDGRPHLVTTLCHPSLSRRWSGGSGWGRSQQLGKPSSRVPTTRHGLRSTTHCRMQLWPPSSWP
     65-350: Missing.

Note: No experimental confirmation available.

Show »
Length:129
Mass (Da):14,735
Checksum:iC94B1F86CA7B53CD
GO
Isoform 4 (identifier: Q6N063-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-164: Missing.

Show »
Length:186
Mass (Da):20,288
Checksum:i5D2FAFD3CEB790F8
GO

Sequence cautioni

The sequence CAE45849.1 differs from that shown. Reason: Frameshift at position 104.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti244 – 2441N → S in CAE45807. 1 PublicationCurated
Sequence conflicti311 – 3111A → T in AAH98119. (PubMed:15489334)Curated
Sequence conflicti311 – 3111A → T in AAI01941. (PubMed:15489334)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 164164Missing in isoform 4. 1 PublicationVSP_025855Add
BLAST
Alternative sequencei1 – 6060Missing in isoform 2. 2 PublicationsVSP_025856Add
BLAST
Alternative sequencei61 – 622LA → MV in isoform 2. 2 PublicationsVSP_025857
Alternative sequencei64 – 641L → WPQEDGRPHLVTTLCHPSLS RRWSGGSGWGRSQQLGKPSS RVPTTRHGLRSTTHCRMQLW PPSSWP in isoform 3. 1 PublicationVSP_025858
Alternative sequencei65 – 350286Missing in isoform 3. 1 PublicationVSP_025859Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK023553 mRNA. Translation: BAB14610.1.
AK094820 mRNA. Translation: BAG52936.1.
CR457316 mRNA. Translation: CAG33597.1.
BX640675 mRNA. Translation: CAE45807.1.
BX640734 mRNA. Translation: CAE45849.1. Sequence problems.
CH471054 Genomic DNA. Translation: EAW98364.1.
BC098119 mRNA. Translation: AAH98119.1.
BC098293 mRNA. Translation: AAH98293.1.
BC101940 mRNA. Translation: AAI01941.1.
BC105637 mRNA. Translation: AAI05638.1.
CCDSiCCDS41855.1. [Q6N063-2]
RefSeqiNP_078899.1. NM_024623.1. [Q6N063-2]
UniGeneiHs.524817.

Genome annotation databases

EnsembliENST00000228922; ENSP00000228922; ENSG00000111325. [Q6N063-1]
ENST00000397389; ENSP00000380544; ENSG00000111325. [Q6N063-2]
ENST00000454694; ENSP00000394175; ENSG00000111325. [Q6N063-4]
ENST00000536150; ENSP00000438327; ENSG00000111325. [Q6N063-4]
ENST00000538628; ENSP00000444608; ENSG00000111325. [Q6N063-4]
ENST00000538755; ENSP00000442817; ENSG00000111325. [Q6N063-4]
ENST00000540324; ENSP00000439667; ENSG00000111325. [Q6N063-3]
ENST00000545317; ENSP00000438192; ENSG00000111325. [Q6N063-4]
ENST00000545612; ENSP00000444436; ENSG00000111325. [Q6N063-4]
GeneIDi79676.
KEGGihsa:79676.
UCSCiuc001uds.1. human. [Q6N063-1]
uc001udz.1. human. [Q6N063-2]

Polymorphism databases

DMDMi156633666.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK023553 mRNA. Translation: BAB14610.1 .
AK094820 mRNA. Translation: BAG52936.1 .
CR457316 mRNA. Translation: CAG33597.1 .
BX640675 mRNA. Translation: CAE45807.1 .
BX640734 mRNA. Translation: CAE45849.1 . Sequence problems.
CH471054 Genomic DNA. Translation: EAW98364.1 .
BC098119 mRNA. Translation: AAH98119.1 .
BC098293 mRNA. Translation: AAH98293.1 .
BC101940 mRNA. Translation: AAI01941.1 .
BC105637 mRNA. Translation: AAI05638.1 .
CCDSi CCDS41855.1. [Q6N063-2 ]
RefSeqi NP_078899.1. NM_024623.1. [Q6N063-2 ]
UniGenei Hs.524817.

3D structure databases

ProteinModelPortali Q6N063.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 122801. 3 interactions.
IntActi Q6N063. 2 interactions.
MINTi MINT-1407968.
STRINGi 9606.ENSP00000380544.

Chemistry

DrugBanki DB00126. Vitamin C.

PTM databases

PhosphoSitei Q6N063.

Polymorphism databases

DMDMi 156633666.

Proteomic databases

MaxQBi Q6N063.
PaxDbi Q6N063.
PRIDEi Q6N063.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000228922 ; ENSP00000228922 ; ENSG00000111325 . [Q6N063-1 ]
ENST00000397389 ; ENSP00000380544 ; ENSG00000111325 . [Q6N063-2 ]
ENST00000454694 ; ENSP00000394175 ; ENSG00000111325 . [Q6N063-4 ]
ENST00000536150 ; ENSP00000438327 ; ENSG00000111325 . [Q6N063-4 ]
ENST00000538628 ; ENSP00000444608 ; ENSG00000111325 . [Q6N063-4 ]
ENST00000538755 ; ENSP00000442817 ; ENSG00000111325 . [Q6N063-4 ]
ENST00000540324 ; ENSP00000439667 ; ENSG00000111325 . [Q6N063-3 ]
ENST00000545317 ; ENSP00000438192 ; ENSG00000111325 . [Q6N063-4 ]
ENST00000545612 ; ENSP00000444436 ; ENSG00000111325 . [Q6N063-4 ]
GeneIDi 79676.
KEGGi hsa:79676.
UCSCi uc001uds.1. human. [Q6N063-1 ]
uc001udz.1. human. [Q6N063-2 ]

Organism-specific databases

CTDi 79676.
GeneCardsi GC12P123459.
H-InvDB HIX0079485.
HGNCi HGNC:25823. OGFOD2.
HPAi HPA039448.
HPA040306.
neXtProti NX_Q6N063.
PharmGKBi PA143485569.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG248193.
GeneTreei ENSGT00390000016796.
HOGENOMi HOG000008117.
HOVERGENi HBG108212.
InParanoidi Q6N063.
OMAi LCPMCCR.
OrthoDBi EOG776SQB.
PhylomeDBi Q6N063.
TreeFami TF329650.

Miscellaneous databases

ChiTaRSi OGFOD2. human.
GenomeRNAii 79676.
NextBioi 68918.
PROi Q6N063.

Gene expression databases

Bgeei Q6N063.
CleanExi HS_OGFOD2.
ExpressionAtlasi Q6N063. baseline.
Genevestigatori Q6N063.

Family and domain databases

InterProi IPR005123. Oxoglu/Fe-dep_dioxygenase.
IPR006620. Pro_4_hyd_alph.
[Graphical view ]
SMARTi SM00702. P4Hc. 1 hit.
[Graphical view ]
PROSITEi PS51471. FE2OG_OXY. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain and Placenta.
  2. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: Colon endothelium and Fetal liver.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).

Entry informationi

Entry nameiOGFD2_HUMAN
AccessioniPrimary (citable) accession number: Q6N063
Secondary accession number(s): B3KT24
, Q4KN13, Q6N023, Q9H8K6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: May 29, 2007
Last modified: October 29, 2014
This is version 83 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3