Q6N063 (OGFD2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 61.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: 2-oxoglutarate and iron-dependent oxygenase domain-containing protein 2 EC=1.14.11.- | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 350 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Cofactor | Binds 1 Fe2+ ion per subunit By similarity. Ascorbate By similarity. |
| Sequence similarities | Belongs to the OGFOD2 family. Contains 1 Fe2OG dioxygenase domain. |
| Sequence caution | The sequence CAE45849.1 differs from that shown. Reason: Erroneous translation. Wrong choice of frame. The sequence CAE45849.1 differs from that shown. Reason: Frameshift at position 104. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Ligand | Iron Metal-binding Vitamin C |
| Molecular function | Dioxygenase Oxidoreductase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Molecular function | L-ascorbic acid binding Inferred from electronic annotation. Source: UniProtKB-KW iron ion bindingInferred from electronic annotation. Source: InterPro oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donorsInferred from electronic annotation. Source: InterPro oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygenInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6N063-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6N063-2) The sequence of this isoform differs from the canonical sequence as follows: 1-60: Missing. 61-62: LA → MV | ||||||
| Isoform 3 (identifier: Q6N063-3) The sequence of this isoform differs from the canonical sequence as follows: 64-64: L → WPQEDGRPHLVTTLCHPSLSRRWSGGSGWGRSQQLGKPSSRVPTTRHGLRSTTHCRMQLWPPSSWP 65-350: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q6N063-4) The sequence of this isoform differs from the canonical sequence as follows: 1-164: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 350 | 350 | 2-oxoglutarate and iron-dependent oxygenase domain-containing protein 2 | PRO_0000288978 | |||||
Regions | |||||||||
| Domain | 215 – 309 | 95 | Fe2OG dioxygenase | ||||||
Sites | |||||||||
| Metal binding | 235 | 1 | Iron By similarity | ||||||
| Metal binding | 237 | 1 | Iron By similarity | ||||||
| Metal binding | 290 | 1 | Iron By similarity | ||||||
| Binding site | 300 | 1 | 2-oxoglutarate Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 164 | 164 | Missing in isoform 4. | VSP_025855 | |||||
| Alternative sequence | 1 – 60 | 60 | Missing in isoform 2. | VSP_025856 | |||||
| Alternative sequence | 61 – 62 | 2 | LA → MV in isoform 2. | VSP_025857 | |||||
| Alternative sequence | 64 | 1 | L → WPQEDGRPHLVTTLCHPSLS RRWSGGSGWGRSQQLGKPSS RVPTTRHGLRSTTHCRMQLW PPSSWP in isoform 3. | VSP_025858 | |||||
| Alternative sequence | 65 – 350 | 286 | Missing in isoform 3. | VSP_025859 | |||||
Experimental info | |||||||||
| Sequence conflict | 244 | 1 | N → S in CAE45807. Ref.2 | ||||||
| Sequence conflict | 311 | 1 | A → T in AAH98119. Ref.5 | ||||||
| Sequence conflict | 311 | 1 | A → T in AAI01941. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Brain and Placenta. |
| [2] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [3] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Tissue: Colon endothelium and Fetal liver. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK023553 mRNA. Translation: BAB14610.1. AK094820 mRNA. Translation: BAG52936.1. CR457316 mRNA. Translation: CAG33597.1. BX640675 mRNA. Translation: CAE45807.1. BX640734 mRNA. Translation: CAE45849.1. Sequence problems. CH471054 Genomic DNA. Translation: EAW98364.1. BC098119 mRNA. Translation: AAH98119.1. BC098293 mRNA. Translation: AAH98293.1. BC101940 mRNA. Translation: AAI01941.1. BC105637 mRNA. Translation: AAI05638.1. |
| IPI | IPI00002458. IPI00794111. IPI00795704. IPI00847506. |
| RefSeq | NP_078899.1. NM_024623.1. |
| UniGene | Hs.524817. |
3D structure databases | |
| ProteinModelPortal | Q6N063. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q6N063. 2 interactions. |
| MINT | MINT-1407968. |
Polymorphism databases | |
| DMDM | 156633666. |
Proteomic databases | |
| PRIDE | Q6N063. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000228922; ENSP00000228922; ENSG00000111325. |
| GeneID | 79676. |
| KEGG | hsa:79676. |
| UCSC | uc001uds.1. human. uc001uea.1. human. |
Organism-specific databases | |
| CTD | 79676. |
| GeneCards | GC12P123459. |
| H-InvDB | HIX0079485. |
| HGNC | HGNC:25823. OGFOD2. |
| HPA | HPA039448. HPA040306. |
| neXtProt | NX_Q6N063. |
| PharmGKB | PA143485569. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG16691. |
| GeneTree | ENSGT00390000016796. |
| HOGENOM | HBG557274. |
| HOVERGEN | HBG108212. |
| InParanoid | Q6N063. |
| OMA | RFLQPLM. |
| OrthoDB | EOG4KKZ3D. |
| PhylomeDB | Q6N063. |
Gene expression databases | |
| ArrayExpress | Q6N063. |
| Bgee | Q6N063. |
| CleanEx | HS_OGFOD2. |
| Genevestigator | Q6N063. |
Family and domain databases | |
| InterPro | IPR005123. Oxoglutarate/Fe-dep_oxygenase. IPR006620. Pro_4_hyd_alph. [Graphical view] |
| SMART | SM00702. P4Hc. 1 hit. [Graphical view] |
| PROSITE | PS51471. FE2OG_OXY. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| DrugBank | DB00126. Vitamin C. |
| NextBio | 68918. |
Entry information
| Entry name | OGFD2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6N063 Secondary accession number(s): B3KT24 Q9H8K6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with