Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q6N043 (Z280D_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 100. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Zinc finger protein 280D
Alternative name(s):
Suppressor of hairy wing homolog 4
Zinc finger protein 634
Gene names
Name:ZNF280D
Synonyms:KIAA1584, SUHW4, ZNF634
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length979 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May function as a transcription factor.

Subcellular location

Nucleus Potential.

Sequence similarities

Contains 5 C2H2-type zinc fingers.

Sequence caution

The sequence BAB13410.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

The sequence CAE46003.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Ontologies

Keywords
   Biological processTranscription
Transcription regulation
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainRepeat
Zinc-finger
   LigandDNA-binding
Metal-binding
Zinc
   PTMPhosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processregulation of transcription, DNA-templated

Inferred from electronic annotation. Source: UniProtKB-KW

transcription, DNA-templated

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentnucleus

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionDNA binding

Inferred from electronic annotation. Source: UniProtKB-KW

metal ion binding

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 6 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q6N043-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q6N043-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: Missing.
Isoform 3 (identifier: Q6N043-3)

The sequence of this isoform differs from the canonical sequence as follows:
     579-592: KPNGSKSKYKPKIS → IVGAFTNALSVVPK
     593-979: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: Q6N043-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-296: Missing.
     687-717: GITLVCLNCDFLSDVSGLDNMATHLSQHKTH → CVGGQIECDLPKLHKLVVEPRLTLGLLTPNF
     718-979: Missing.
Note: No experimental confirmation available.
Isoform 5 (identifier: Q6N043-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-759: Missing.
Note: No experimental confirmation available.
Isoform 6 (identifier: Q6N043-6)

The sequence of this isoform differs from the canonical sequence as follows:
     128-158: GYITNSSRVVSNKSSELLFDLTQDTGLSHYQ → VSVSKTIRPAQGSIGCCLSISTVPSYNSGLS
     159-979: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 979979Zinc finger protein 280D
PRO_0000227977

Regions

Zinc finger321 – 34323C2H2-type 1
Zinc finger358 – 38124C2H2-type 2
Zinc finger388 – 41225C2H2-type 3; degenerate
Zinc finger418 – 44124C2H2-type 4
Zinc finger449 – 46921C2H2-type 5
Compositional bias20 – 278Poly-Glu
Compositional bias38 – 425Poly-Asp

Amino acid modifications

Modified residue1041Phosphoserine Ref.9
Modified residue5451Phosphoserine Ref.7 Ref.8

Natural variations

Alternative sequence1 – 759759Missing in isoform 5.
VSP_017622
Alternative sequence1 – 296296Missing in isoform 4.
VSP_017623
Alternative sequence1 – 1313Missing in isoform 2.
VSP_017624
Alternative sequence128 – 15831GYITN…LSHYQ → VSVSKTIRPAQGSIGCCLSI STVPSYNSGLS in isoform 6.
VSP_054317
Alternative sequence159 – 979821Missing in isoform 6.
VSP_054318
Alternative sequence579 – 59214KPNGS…KPKIS → IVGAFTNALSVVPK in isoform 3.
VSP_017625
Alternative sequence593 – 979387Missing in isoform 3.
VSP_017626
Alternative sequence687 – 71731GITLV…QHKTH → CVGGQIECDLPKLHKLVVEP RLTLGLLTPNF in isoform 4.
VSP_017627
Alternative sequence718 – 979262Missing in isoform 4.
VSP_017628
Natural variant5681V → I. Ref.1 Ref.3 Ref.4 Ref.6
Corresponds to variant rs28620278 [ dbSNP | Ensembl ].
VAR_054314
Natural variant7781A → V.
Corresponds to variant rs12900993 [ dbSNP | Ensembl ].
VAR_054315
Natural variant7811K → I.
Corresponds to variant rs12901843 [ dbSNP | Ensembl ].
VAR_054316
Natural variant7851G → A.
Corresponds to variant rs12900729 [ dbSNP | Ensembl ].
VAR_054317

Experimental info

Sequence conflict2291S → P in CAE46003. Ref.4
Sequence conflict2521L → W in CAE45785. Ref.4
Sequence conflict2741A → T in CAE45785. Ref.4
Sequence conflict5441L → P in BAA90940. Ref.3
Sequence conflict7421E → R in CAE45827. Ref.4

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified February 10, 2009. Version 3.
Checksum: 9B11A04F21298503

FASTA979109,285
        10         20         30         40         50         60 
MGDNPFQPKS NSKMAELFME CEEEELEPWQ KKVKEVEDDD DDEPIFVGEI SSSKPAISNI 

        70         80         90        100        110        120 
LNRVNPSSYS RGLKNGALSR GITAAFKPTS QHYTNPTSNP VPASPINFHP ESRSSDSSVI 

       130        140        150        160        170        180 
VQPFSKPGYI TNSSRVVSNK SSELLFDLTQ DTGLSHYQGG PTLSMAGMSE SSFLSKRPST 

       190        200        210        220        230        240 
SEVNNVNPKK PKPSESVSGA NSSAVLPSVK SPSVTSSQAM LAKGTNTSSN QSKNGTPFPR 

       250        260        270        280        290        300 
ACPKCNIHFN LLDPLKNHMK YCCPDMINNF LGLAKTEFSS TVNKNTTIDS EKGKLIMLVN 

       310        320        330        340        350        360 
DFYYGKHEGD VQEEQKTHTT FKCFSCLKIL KNNIRFMNHM KHHLELEKQS SESWENHTTC 

       370        380        390        400        410        420 
QHCYRQFPTP FQLQCHIEST HTPHEFSTIC KICELSFETE HVLLQHMKDN HKPGEMPYVC 

       430        440        450        460        470        480 
QVCNYRSSSF SDVETHFRTS HENTKNLLCP FCLKVIKIAT PYMHHYMKHQ KKGIHRCTKC 

       490        500        510        520        530        540 
RLQFLTCKEK MDHKTQHHRT FIKPKQLEGL PPGTKVTIRA SVGPLQSGAS PTPSISASAS 

       550        560        570        580        590        600 
TLQLSPPRTK NITAKNPAKS NTSKPNTVKS NASKPNTSKP NGSKSKYKPK ISNMQKKQST 

       610        620        630        640        650        660 
LASSNKKSKV NTALRNLRYR RGIHKCIECC SEIKDFANHF PTYVHCSFCR YNTSCSKAYV 

       670        680        690        700        710        720 
NHMMSFHSNR PSKRFCIFKK HSENLRGITL VCLNCDFLSD VSGLDNMATH LSQHKTHTCQ 

       730        740        750        760        770        780 
VVMQKVSVCI PTSEHLSELK KEAPAKEQEP VSKEIARPNM AERETETSNS ESKQDKAASS 

       790        800        810        820        830        840 
KEKNGCNANS FEGSSTTKSE ESITVSDKEN ETCLADQETG SKNIVSCDSN IGADKVEKKK 

       850        860        870        880        890        900 
QIQHVCQEME LKMCQSSENI ILSDQIKDHN SSEARFSSKN IKDLRLASDN VSIDQFLRKR 

       910        920        930        940        950        960 
HEPESVSSDV SEQGSIHLEP LTPSEVLEYE ATEILQKGSG DPSAKTDEVV SDQTDDIPGG 

       970 
NNPSTTEATV DLEDEKERS 

« Hide

Isoform 2 [UniParc].

Checksum: BD9D30A70160AD5D
Show »

FASTA966107,853
Isoform 3 [UniParc].

Checksum: 72225464735559EE
Show »

FASTA59265,943
Isoform 4 [UniParc].

Checksum: 88871CD7BBC6D00D
Show »

FASTA42148,513
Isoform 5 [UniParc].

Checksum: 541C05BE7DD020D7
Show »

FASTA22024,109
Isoform 6 [UniParc].

Checksum: 19B2BFFFC789BA92
Show »

FASTA15817,134

References

[1]"Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.
DNA Res. 7:273-281(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ILE-568.
Tissue: Brain.
[2]"Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs."
Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. expand/collapse author list , Tampe J., Heubner D., Wambutt R., Korn B., Klein M., Poustka A.
Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
Tissue: Brain.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), VARIANT ILE-568.
Tissue: Colon.
[4]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3), VARIANT ILE-568.
Tissue: Colon endothelium, Liver and Uterine endothelium.
[5]"Analysis of the DNA sequence and duplication history of human chromosome 15."
Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A. expand/collapse author list , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 6), VARIANT ILE-568.
Tissue: Brain, Liver, Skin and Uterus.
[7]"Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-545, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[8]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-545, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[9]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-104, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB046804 mRNA. Translation: BAB13410.1. Different initiation.
AK000093 mRNA. Translation: BAA90940.1.
AL136634 mRNA. Translation: CAB66569.1.
BX640637 mRNA. Translation: CAE45785.1.
BX640707 mRNA. Translation: CAE45827.1.
BX641000 mRNA. Translation: CAE46003.1. Different initiation.
AC010999 Genomic DNA. No translation available.
AC090517 Genomic DNA. No translation available.
AC090518 Genomic DNA. No translation available.
BC015382 mRNA. Translation: AAH15382.2.
BC053649 mRNA. Translation: AAH53649.2.
BC064359 mRNA. Translation: AAH64359.1.
BC130451 mRNA. Translation: AAI30452.1.
BC136412 mRNA. Translation: AAI36413.1.
CCDSCCDS32245.1. [Q6N043-1]
CCDS42041.1. [Q6N043-2]
RefSeqNP_001002843.1. NM_001002843.2. [Q6N043-2]
NP_001002844.1. NM_001002844.2. [Q6N043-6]
NP_001275517.1. NM_001288588.1. [Q6N043-1]
NP_001275518.1. NM_001288589.1. [Q6N043-6]
NP_060131.2. NM_017661.3. [Q6N043-1]
UniGeneHs.511477.

3D structure databases

ProteinModelPortalQ6N043.
SMRQ6N043. Positions 320-497, 644-676.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid120173. 5 interactions.
IntActQ6N043. 2 interactions.
MINTMINT-4716449.
STRING9606.ENSP00000267807.

PTM databases

PhosphoSiteQ6N043.

Polymorphism databases

DMDM223634726.

Proteomic databases

MaxQBQ6N043.
PaxDbQ6N043.
PRIDEQ6N043.

Protocols and materials databases

DNASU54816.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000267807; ENSP00000267807; ENSG00000137871. [Q6N043-1]
ENST00000396245; ENSP00000379545; ENSG00000137871. [Q6N043-4]
ENST00000558067; ENSP00000454173; ENSG00000137871. [Q6N043-4]
ENST00000558320; ENSP00000453706; ENSG00000137871.
ENST00000559237; ENSP00000454111; ENSG00000137871. [Q6N043-2]
ENST00000560002; ENSP00000453636; ENSG00000137871. [Q6N043-3]
GeneID54816.
KEGGhsa:54816.
UCSCuc002adt.3. human. [Q6N043-5]
uc002adu.3. human. [Q6N043-1]

Organism-specific databases

CTD54816.
GeneCardsGC15M056922.
HGNCHGNC:25953. ZNF280D.
HPAHPA030233.
neXtProtNX_Q6N043.
PharmGKBPA162410004.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG239493.
HOVERGENHBG060885.
InParanoidQ6N043.
OMAHYQGGPT.
OrthoDBEOG7QVM24.
PhylomeDBQ6N043.
TreeFamTF331707.

Gene expression databases

ArrayExpressQ6N043.
BgeeQ6N043.
CleanExHS_ZNF280D.
GenevestigatorQ6N043.

Family and domain databases

InterProIPR025243. DUF4195.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
[Graphical view]
PfamPF13836. DUF4195. 1 hit.
[Graphical view]
SMARTSM00355. ZnF_C2H2. 9 hits.
[Graphical view]
PROSITEPS00028. ZINC_FINGER_C2H2_1. 5 hits.
PS50157. ZINC_FINGER_C2H2_2. 2 hits.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiSUHW4.
GenomeRNAi54816.
NextBio57557.
PROQ6N043.

Entry information

Entry nameZ280D_HUMAN
AccessionPrimary (citable) accession number: Q6N043
Secondary accession number(s): A1L495 expand/collapse secondary AC list , B2RMT6, Q6MZM6, Q6N085, Q6P2R6, Q7Z6J5, Q9H0U5, Q9HCI8, Q9NXS0
Entry history
Integrated into UniProtKB/Swiss-Prot: March 21, 2006
Last sequence update: February 10, 2009
Last modified: July 9, 2014
This is version 100 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 15

Human chromosome 15: entries, gene names and cross-references to MIM