Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6N043

- Z280D_HUMAN

UniProt

Q6N043 - Z280D_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Zinc finger protein 280D

Gene

ZNF280D

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May function as a transcription factor.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri321 – 34323C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri358 – 38124C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri388 – 41225C2H2-type 3; degeneratePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri418 – 44124C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri449 – 46921C2H2-type 5PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. DNA binding Source: UniProtKB-KW
  2. metal ion binding Source: UniProtKB-KW

GO - Biological processi

  1. regulation of transcription, DNA-templated Source: UniProtKB-KW
  2. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 280D
Alternative name(s):
Suppressor of hairy wing homolog 4
Zinc finger protein 634
Gene namesi
Name:ZNF280D
Synonyms:KIAA1584, SUHW4, ZNF634
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 15

Organism-specific databases

HGNCiHGNC:25953. ZNF280D.

Subcellular locationi

Nucleus Curated

GO - Cellular componenti

  1. nucleus Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162410004.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 979979Zinc finger protein 280DPRO_0000227977Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei104 – 1041Phosphoserine1 Publication
Modified residuei545 – 5451Phosphoserine2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ6N043.
PaxDbiQ6N043.
PRIDEiQ6N043.

PTM databases

PhosphoSiteiQ6N043.

Expressioni

Gene expression databases

BgeeiQ6N043.
CleanExiHS_ZNF280D.
ExpressionAtlasiQ6N043. baseline and differential.
GenevestigatoriQ6N043.

Organism-specific databases

HPAiHPA030233.

Interactioni

Protein-protein interaction databases

BioGridi120173. 5 interactions.
IntActiQ6N043. 2 interactions.
MINTiMINT-4716449.
STRINGi9606.ENSP00000267807.

Structurei

3D structure databases

ProteinModelPortaliQ6N043.
SMRiQ6N043. Positions 315-508, 644-676.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi20 – 278Poly-Glu
Compositional biasi38 – 425Poly-Asp

Sequence similaritiesi

Contains 5 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri321 – 34323C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri358 – 38124C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri388 – 41225C2H2-type 3; degeneratePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri418 – 44124C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri449 – 46921C2H2-type 5PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiNOG239493.
GeneTreeiENSGT00530000063300.
HOVERGENiHBG060885.
InParanoidiQ6N043.
OMAiHYQGGPT.
OrthoDBiEOG7QVM24.
PhylomeDBiQ6N043.
TreeFamiTF331707.

Family and domain databases

InterProiIPR025243. DUF4195.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
[Graphical view]
PfamiPF13836. DUF4195. 1 hit.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 9 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 5 hits.
PS50157. ZINC_FINGER_C2H2_2. 2 hits.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6N043-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGDNPFQPKS NSKMAELFME CEEEELEPWQ KKVKEVEDDD DDEPIFVGEI
60 70 80 90 100
SSSKPAISNI LNRVNPSSYS RGLKNGALSR GITAAFKPTS QHYTNPTSNP
110 120 130 140 150
VPASPINFHP ESRSSDSSVI VQPFSKPGYI TNSSRVVSNK SSELLFDLTQ
160 170 180 190 200
DTGLSHYQGG PTLSMAGMSE SSFLSKRPST SEVNNVNPKK PKPSESVSGA
210 220 230 240 250
NSSAVLPSVK SPSVTSSQAM LAKGTNTSSN QSKNGTPFPR ACPKCNIHFN
260 270 280 290 300
LLDPLKNHMK YCCPDMINNF LGLAKTEFSS TVNKNTTIDS EKGKLIMLVN
310 320 330 340 350
DFYYGKHEGD VQEEQKTHTT FKCFSCLKIL KNNIRFMNHM KHHLELEKQS
360 370 380 390 400
SESWENHTTC QHCYRQFPTP FQLQCHIEST HTPHEFSTIC KICELSFETE
410 420 430 440 450
HVLLQHMKDN HKPGEMPYVC QVCNYRSSSF SDVETHFRTS HENTKNLLCP
460 470 480 490 500
FCLKVIKIAT PYMHHYMKHQ KKGIHRCTKC RLQFLTCKEK MDHKTQHHRT
510 520 530 540 550
FIKPKQLEGL PPGTKVTIRA SVGPLQSGAS PTPSISASAS TLQLSPPRTK
560 570 580 590 600
NITAKNPAKS NTSKPNTVKS NASKPNTSKP NGSKSKYKPK ISNMQKKQST
610 620 630 640 650
LASSNKKSKV NTALRNLRYR RGIHKCIECC SEIKDFANHF PTYVHCSFCR
660 670 680 690 700
YNTSCSKAYV NHMMSFHSNR PSKRFCIFKK HSENLRGITL VCLNCDFLSD
710 720 730 740 750
VSGLDNMATH LSQHKTHTCQ VVMQKVSVCI PTSEHLSELK KEAPAKEQEP
760 770 780 790 800
VSKEIARPNM AERETETSNS ESKQDKAASS KEKNGCNANS FEGSSTTKSE
810 820 830 840 850
ESITVSDKEN ETCLADQETG SKNIVSCDSN IGADKVEKKK QIQHVCQEME
860 870 880 890 900
LKMCQSSENI ILSDQIKDHN SSEARFSSKN IKDLRLASDN VSIDQFLRKR
910 920 930 940 950
HEPESVSSDV SEQGSIHLEP LTPSEVLEYE ATEILQKGSG DPSAKTDEVV
960 970
SDQTDDIPGG NNPSTTEATV DLEDEKERS
Length:979
Mass (Da):109,285
Last modified:February 10, 2009 - v3
Checksum:i9B11A04F21298503
GO
Isoform 2 (identifier: Q6N043-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: Missing.

Show »
Length:966
Mass (Da):107,853
Checksum:iBD9D30A70160AD5D
GO
Isoform 3 (identifier: Q6N043-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     579-592: KPNGSKSKYKPKIS → IVGAFTNALSVVPK
     593-979: Missing.

Note: No experimental confirmation available.

Show »
Length:592
Mass (Da):65,943
Checksum:i72225464735559EE
GO
Isoform 4 (identifier: Q6N043-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-296: Missing.
     687-717: GITLVCLNCDFLSDVSGLDNMATHLSQHKTH → CVGGQIECDLPKLHKLVVEPRLTLGLLTPNF
     718-979: Missing.

Note: No experimental confirmation available.

Show »
Length:421
Mass (Da):48,513
Checksum:i88871CD7BBC6D00D
GO
Isoform 5 (identifier: Q6N043-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-759: Missing.

Note: No experimental confirmation available.

Show »
Length:220
Mass (Da):24,109
Checksum:i541C05BE7DD020D7
GO
Isoform 6 (identifier: Q6N043-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     128-158: GYITNSSRVVSNKSSELLFDLTQDTGLSHYQ → VSVSKTIRPAQGSIGCCLSISTVPSYNSGLS
     159-979: Missing.

Show »
Length:158
Mass (Da):17,134
Checksum:i19B2BFFFC789BA92
GO

Sequence cautioni

The sequence BAB13410.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence CAE46003.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti229 – 2291S → P in CAE46003. (PubMed:17974005)Curated
Sequence conflicti252 – 2521L → W in CAE45785. (PubMed:17974005)Curated
Sequence conflicti274 – 2741A → T in CAE45785. (PubMed:17974005)Curated
Sequence conflicti544 – 5441L → P in BAA90940. (PubMed:14702039)Curated
Sequence conflicti742 – 7421E → R in CAE45827. (PubMed:17974005)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti568 – 5681V → I.4 Publications
Corresponds to variant rs28620278 [ dbSNP | Ensembl ].
VAR_054314
Natural varianti778 – 7781A → V.
Corresponds to variant rs12900993 [ dbSNP | Ensembl ].
VAR_054315
Natural varianti781 – 7811K → I.
Corresponds to variant rs12901843 [ dbSNP | Ensembl ].
VAR_054316
Natural varianti785 – 7851G → A.
Corresponds to variant rs12900729 [ dbSNP | Ensembl ].
VAR_054317

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 759759Missing in isoform 5. 1 PublicationVSP_017622Add
BLAST
Alternative sequencei1 – 296296Missing in isoform 4. 1 PublicationVSP_017623Add
BLAST
Alternative sequencei1 – 1313Missing in isoform 2. 2 PublicationsVSP_017624Add
BLAST
Alternative sequencei128 – 15831GYITN…LSHYQ → VSVSKTIRPAQGSIGCCLSI STVPSYNSGLS in isoform 6. 1 PublicationVSP_054317Add
BLAST
Alternative sequencei159 – 979821Missing in isoform 6. 1 PublicationVSP_054318Add
BLAST
Alternative sequencei579 – 59214KPNGS…KPKIS → IVGAFTNALSVVPK in isoform 3. 1 PublicationVSP_017625Add
BLAST
Alternative sequencei593 – 979387Missing in isoform 3. 1 PublicationVSP_017626Add
BLAST
Alternative sequencei687 – 71731GITLV…QHKTH → CVGGQIECDLPKLHKLVVEP RLTLGLLTPNF in isoform 4. 1 PublicationVSP_017627Add
BLAST
Alternative sequencei718 – 979262Missing in isoform 4. 1 PublicationVSP_017628Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB046804 mRNA. Translation: BAB13410.1. Different initiation.
AK000093 mRNA. Translation: BAA90940.1.
AL136634 mRNA. Translation: CAB66569.1.
BX640637 mRNA. Translation: CAE45785.1.
BX640707 mRNA. Translation: CAE45827.1.
BX641000 mRNA. Translation: CAE46003.1. Different initiation.
AC010999 Genomic DNA. No translation available.
AC090517 Genomic DNA. No translation available.
AC090518 Genomic DNA. No translation available.
BC015382 mRNA. Translation: AAH15382.2.
BC053649 mRNA. Translation: AAH53649.2.
BC064359 mRNA. Translation: AAH64359.1.
BC130451 mRNA. Translation: AAI30452.1.
BC136412 mRNA. Translation: AAI36413.1.
CCDSiCCDS32245.1. [Q6N043-1]
CCDS42041.1. [Q6N043-2]
CCDS58364.1. [Q6N043-6]
RefSeqiNP_001002843.1. NM_001002843.2. [Q6N043-2]
NP_001002844.1. NM_001002844.2. [Q6N043-6]
NP_001275517.1. NM_001288588.1. [Q6N043-1]
NP_001275518.1. NM_001288589.1. [Q6N043-6]
NP_060131.2. NM_017661.3. [Q6N043-1]
UniGeneiHs.511477.

Genome annotation databases

EnsembliENST00000267807; ENSP00000267807; ENSG00000137871. [Q6N043-1]
ENST00000558067; ENSP00000454173; ENSG00000137871. [Q6N043-4]
ENST00000558320; ENSP00000453706; ENSG00000137871. [Q6N043-6]
ENST00000559237; ENSP00000454111; ENSG00000137871. [Q6N043-2]
ENST00000560002; ENSP00000453636; ENSG00000137871. [Q6N043-3]
GeneIDi54816.
KEGGihsa:54816.
UCSCiuc002adt.3. human. [Q6N043-5]
uc002adu.3. human. [Q6N043-1]
uc002adx.3. human.

Polymorphism databases

DMDMi223634726.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB046804 mRNA. Translation: BAB13410.1 . Different initiation.
AK000093 mRNA. Translation: BAA90940.1 .
AL136634 mRNA. Translation: CAB66569.1 .
BX640637 mRNA. Translation: CAE45785.1 .
BX640707 mRNA. Translation: CAE45827.1 .
BX641000 mRNA. Translation: CAE46003.1 . Different initiation.
AC010999 Genomic DNA. No translation available.
AC090517 Genomic DNA. No translation available.
AC090518 Genomic DNA. No translation available.
BC015382 mRNA. Translation: AAH15382.2 .
BC053649 mRNA. Translation: AAH53649.2 .
BC064359 mRNA. Translation: AAH64359.1 .
BC130451 mRNA. Translation: AAI30452.1 .
BC136412 mRNA. Translation: AAI36413.1 .
CCDSi CCDS32245.1. [Q6N043-1 ]
CCDS42041.1. [Q6N043-2 ]
CCDS58364.1. [Q6N043-6 ]
RefSeqi NP_001002843.1. NM_001002843.2. [Q6N043-2 ]
NP_001002844.1. NM_001002844.2. [Q6N043-6 ]
NP_001275517.1. NM_001288588.1. [Q6N043-1 ]
NP_001275518.1. NM_001288589.1. [Q6N043-6 ]
NP_060131.2. NM_017661.3. [Q6N043-1 ]
UniGenei Hs.511477.

3D structure databases

ProteinModelPortali Q6N043.
SMRi Q6N043. Positions 315-508, 644-676.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120173. 5 interactions.
IntActi Q6N043. 2 interactions.
MINTi MINT-4716449.
STRINGi 9606.ENSP00000267807.

PTM databases

PhosphoSitei Q6N043.

Polymorphism databases

DMDMi 223634726.

Proteomic databases

MaxQBi Q6N043.
PaxDbi Q6N043.
PRIDEi Q6N043.

Protocols and materials databases

DNASUi 54816.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000267807 ; ENSP00000267807 ; ENSG00000137871 . [Q6N043-1 ]
ENST00000558067 ; ENSP00000454173 ; ENSG00000137871 . [Q6N043-4 ]
ENST00000558320 ; ENSP00000453706 ; ENSG00000137871 . [Q6N043-6 ]
ENST00000559237 ; ENSP00000454111 ; ENSG00000137871 . [Q6N043-2 ]
ENST00000560002 ; ENSP00000453636 ; ENSG00000137871 . [Q6N043-3 ]
GeneIDi 54816.
KEGGi hsa:54816.
UCSCi uc002adt.3. human. [Q6N043-5 ]
uc002adu.3. human. [Q6N043-1 ]
uc002adx.3. human.

Organism-specific databases

CTDi 54816.
GeneCardsi GC15M056922.
HGNCi HGNC:25953. ZNF280D.
HPAi HPA030233.
neXtProti NX_Q6N043.
PharmGKBi PA162410004.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG239493.
GeneTreei ENSGT00530000063300.
HOVERGENi HBG060885.
InParanoidi Q6N043.
OMAi HYQGGPT.
OrthoDBi EOG7QVM24.
PhylomeDBi Q6N043.
TreeFami TF331707.

Miscellaneous databases

ChiTaRSi ZNF280D. human.
GeneWikii SUHW4.
GenomeRNAii 54816.
NextBioi 57557.
PROi Q6N043.

Gene expression databases

Bgeei Q6N043.
CleanExi HS_ZNF280D.
ExpressionAtlasi Q6N043. baseline and differential.
Genevestigatori Q6N043.

Family and domain databases

InterProi IPR025243. DUF4195.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
[Graphical view ]
Pfami PF13836. DUF4195. 1 hit.
[Graphical view ]
SMARTi SM00355. ZnF_C2H2. 9 hits.
[Graphical view ]
PROSITEi PS00028. ZINC_FINGER_C2H2_1. 5 hits.
PS50157. ZINC_FINGER_C2H2_2. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.
    DNA Res. 7:273-281(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ILE-568.
    Tissue: Brain.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
    Tissue: Brain.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), VARIANT ILE-568.
    Tissue: Colon.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3), VARIANT ILE-568.
    Tissue: Colon endothelium, Liver and Uterine endothelium.
  5. "Analysis of the DNA sequence and duplication history of human chromosome 15."
    Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
    , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
    Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 6), VARIANT ILE-568.
    Tissue: Brain, Liver, Skin and Uterus.
  7. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
    Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
    J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-545, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-545, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-104, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiZ280D_HUMAN
AccessioniPrimary (citable) accession number: Q6N043
Secondary accession number(s): A1L495
, B2RMT6, Q6MZM6, Q6N085, Q6P2R6, Q7Z6J5, Q9H0U5, Q9HCI8, Q9NXS0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 21, 2006
Last sequence update: February 10, 2009
Last modified: November 26, 2014
This is version 104 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3