Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6N043

- Z280D_HUMAN

UniProt

Q6N043 - Z280D_HUMAN

Protein

Zinc finger protein 280D

Gene

ZNF280D

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 102 (01 Oct 2014)
      Sequence version 3 (10 Feb 2009)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May function as a transcription factor.

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri321 – 34323C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri358 – 38124C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri388 – 41225C2H2-type 3; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri418 – 44124C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri449 – 46921C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. DNA binding Source: UniProtKB-KW
    2. metal ion binding Source: UniProtKB-KW

    GO - Biological processi

    1. regulation of transcription, DNA-templated Source: UniProtKB-KW
    2. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding, Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Zinc finger protein 280D
    Alternative name(s):
    Suppressor of hairy wing homolog 4
    Zinc finger protein 634
    Gene namesi
    Name:ZNF280D
    Synonyms:KIAA1584, SUHW4, ZNF634
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 15

    Organism-specific databases

    HGNCiHGNC:25953. ZNF280D.

    Subcellular locationi

    Nucleus Curated

    GO - Cellular componenti

    1. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA162410004.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 979979Zinc finger protein 280DPRO_0000227977Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei104 – 1041Phosphoserine1 Publication
    Modified residuei545 – 5451Phosphoserine2 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ6N043.
    PaxDbiQ6N043.
    PRIDEiQ6N043.

    PTM databases

    PhosphoSiteiQ6N043.

    Expressioni

    Gene expression databases

    ArrayExpressiQ6N043.
    BgeeiQ6N043.
    CleanExiHS_ZNF280D.
    GenevestigatoriQ6N043.

    Organism-specific databases

    HPAiHPA030233.

    Interactioni

    Protein-protein interaction databases

    BioGridi120173. 5 interactions.
    IntActiQ6N043. 2 interactions.
    MINTiMINT-4716449.
    STRINGi9606.ENSP00000267807.

    Structurei

    3D structure databases

    ProteinModelPortaliQ6N043.
    SMRiQ6N043. Positions 320-497, 644-676.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi20 – 278Poly-Glu
    Compositional biasi38 – 425Poly-Asp

    Sequence similaritiesi

    Contains 5 C2H2-type zinc fingers.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri321 – 34323C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri358 – 38124C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri388 – 41225C2H2-type 3; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri418 – 44124C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri449 – 46921C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiNOG239493.
    HOVERGENiHBG060885.
    InParanoidiQ6N043.
    OMAiHYQGGPT.
    OrthoDBiEOG7QVM24.
    PhylomeDBiQ6N043.
    TreeFamiTF331707.

    Family and domain databases

    InterProiIPR025243. DUF4195.
    IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    [Graphical view]
    PfamiPF13836. DUF4195. 1 hit.
    [Graphical view]
    SMARTiSM00355. ZnF_C2H2. 9 hits.
    [Graphical view]
    PROSITEiPS00028. ZINC_FINGER_C2H2_1. 5 hits.
    PS50157. ZINC_FINGER_C2H2_2. 2 hits.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6N043-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGDNPFQPKS NSKMAELFME CEEEELEPWQ KKVKEVEDDD DDEPIFVGEI    50
    SSSKPAISNI LNRVNPSSYS RGLKNGALSR GITAAFKPTS QHYTNPTSNP 100
    VPASPINFHP ESRSSDSSVI VQPFSKPGYI TNSSRVVSNK SSELLFDLTQ 150
    DTGLSHYQGG PTLSMAGMSE SSFLSKRPST SEVNNVNPKK PKPSESVSGA 200
    NSSAVLPSVK SPSVTSSQAM LAKGTNTSSN QSKNGTPFPR ACPKCNIHFN 250
    LLDPLKNHMK YCCPDMINNF LGLAKTEFSS TVNKNTTIDS EKGKLIMLVN 300
    DFYYGKHEGD VQEEQKTHTT FKCFSCLKIL KNNIRFMNHM KHHLELEKQS 350
    SESWENHTTC QHCYRQFPTP FQLQCHIEST HTPHEFSTIC KICELSFETE 400
    HVLLQHMKDN HKPGEMPYVC QVCNYRSSSF SDVETHFRTS HENTKNLLCP 450
    FCLKVIKIAT PYMHHYMKHQ KKGIHRCTKC RLQFLTCKEK MDHKTQHHRT 500
    FIKPKQLEGL PPGTKVTIRA SVGPLQSGAS PTPSISASAS TLQLSPPRTK 550
    NITAKNPAKS NTSKPNTVKS NASKPNTSKP NGSKSKYKPK ISNMQKKQST 600
    LASSNKKSKV NTALRNLRYR RGIHKCIECC SEIKDFANHF PTYVHCSFCR 650
    YNTSCSKAYV NHMMSFHSNR PSKRFCIFKK HSENLRGITL VCLNCDFLSD 700
    VSGLDNMATH LSQHKTHTCQ VVMQKVSVCI PTSEHLSELK KEAPAKEQEP 750
    VSKEIARPNM AERETETSNS ESKQDKAASS KEKNGCNANS FEGSSTTKSE 800
    ESITVSDKEN ETCLADQETG SKNIVSCDSN IGADKVEKKK QIQHVCQEME 850
    LKMCQSSENI ILSDQIKDHN SSEARFSSKN IKDLRLASDN VSIDQFLRKR 900
    HEPESVSSDV SEQGSIHLEP LTPSEVLEYE ATEILQKGSG DPSAKTDEVV 950
    SDQTDDIPGG NNPSTTEATV DLEDEKERS 979
    Length:979
    Mass (Da):109,285
    Last modified:February 10, 2009 - v3
    Checksum:i9B11A04F21298503
    GO
    Isoform 2 (identifier: Q6N043-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-13: Missing.

    Show »
    Length:966
    Mass (Da):107,853
    Checksum:iBD9D30A70160AD5D
    GO
    Isoform 3 (identifier: Q6N043-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         579-592: KPNGSKSKYKPKIS → IVGAFTNALSVVPK
         593-979: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:592
    Mass (Da):65,943
    Checksum:i72225464735559EE
    GO
    Isoform 4 (identifier: Q6N043-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-296: Missing.
         687-717: GITLVCLNCDFLSDVSGLDNMATHLSQHKTH → CVGGQIECDLPKLHKLVVEPRLTLGLLTPNF
         718-979: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:421
    Mass (Da):48,513
    Checksum:i88871CD7BBC6D00D
    GO
    Isoform 5 (identifier: Q6N043-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-759: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:220
    Mass (Da):24,109
    Checksum:i541C05BE7DD020D7
    GO
    Isoform 6 (identifier: Q6N043-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         128-158: GYITNSSRVVSNKSSELLFDLTQDTGLSHYQ → VSVSKTIRPAQGSIGCCLSISTVPSYNSGLS
         159-979: Missing.

    Show »
    Length:158
    Mass (Da):17,134
    Checksum:i19B2BFFFC789BA92
    GO

    Sequence cautioni

    The sequence BAB13410.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence CAE46003.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti229 – 2291S → P in CAE46003. (PubMed:17974005)Curated
    Sequence conflicti252 – 2521L → W in CAE45785. (PubMed:17974005)Curated
    Sequence conflicti274 – 2741A → T in CAE45785. (PubMed:17974005)Curated
    Sequence conflicti544 – 5441L → P in BAA90940. (PubMed:14702039)Curated
    Sequence conflicti742 – 7421E → R in CAE45827. (PubMed:17974005)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti568 – 5681V → I.4 Publications
    Corresponds to variant rs28620278 [ dbSNP | Ensembl ].
    VAR_054314
    Natural varianti778 – 7781A → V.
    Corresponds to variant rs12900993 [ dbSNP | Ensembl ].
    VAR_054315
    Natural varianti781 – 7811K → I.
    Corresponds to variant rs12901843 [ dbSNP | Ensembl ].
    VAR_054316
    Natural varianti785 – 7851G → A.
    Corresponds to variant rs12900729 [ dbSNP | Ensembl ].
    VAR_054317

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 759759Missing in isoform 5. 1 PublicationVSP_017622Add
    BLAST
    Alternative sequencei1 – 296296Missing in isoform 4. 1 PublicationVSP_017623Add
    BLAST
    Alternative sequencei1 – 1313Missing in isoform 2. 2 PublicationsVSP_017624Add
    BLAST
    Alternative sequencei128 – 15831GYITN…LSHYQ → VSVSKTIRPAQGSIGCCLSI STVPSYNSGLS in isoform 6. 1 PublicationVSP_054317Add
    BLAST
    Alternative sequencei159 – 979821Missing in isoform 6. 1 PublicationVSP_054318Add
    BLAST
    Alternative sequencei579 – 59214KPNGS…KPKIS → IVGAFTNALSVVPK in isoform 3. 1 PublicationVSP_017625Add
    BLAST
    Alternative sequencei593 – 979387Missing in isoform 3. 1 PublicationVSP_017626Add
    BLAST
    Alternative sequencei687 – 71731GITLV…QHKTH → CVGGQIECDLPKLHKLVVEP RLTLGLLTPNF in isoform 4. 1 PublicationVSP_017627Add
    BLAST
    Alternative sequencei718 – 979262Missing in isoform 4. 1 PublicationVSP_017628Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB046804 mRNA. Translation: BAB13410.1. Different initiation.
    AK000093 mRNA. Translation: BAA90940.1.
    AL136634 mRNA. Translation: CAB66569.1.
    BX640637 mRNA. Translation: CAE45785.1.
    BX640707 mRNA. Translation: CAE45827.1.
    BX641000 mRNA. Translation: CAE46003.1. Different initiation.
    AC010999 Genomic DNA. No translation available.
    AC090517 Genomic DNA. No translation available.
    AC090518 Genomic DNA. No translation available.
    BC015382 mRNA. Translation: AAH15382.2.
    BC053649 mRNA. Translation: AAH53649.2.
    BC064359 mRNA. Translation: AAH64359.1.
    BC130451 mRNA. Translation: AAI30452.1.
    BC136412 mRNA. Translation: AAI36413.1.
    CCDSiCCDS32245.1. [Q6N043-1]
    CCDS42041.1. [Q6N043-2]
    CCDS58364.1. [Q6N043-6]
    RefSeqiNP_001002843.1. NM_001002843.2. [Q6N043-2]
    NP_001002844.1. NM_001002844.2. [Q6N043-6]
    NP_001275517.1. NM_001288588.1. [Q6N043-1]
    NP_001275518.1. NM_001288589.1. [Q6N043-6]
    NP_060131.2. NM_017661.3. [Q6N043-1]
    UniGeneiHs.511477.

    Genome annotation databases

    EnsembliENST00000267807; ENSP00000267807; ENSG00000137871. [Q6N043-1]
    ENST00000558067; ENSP00000454173; ENSG00000137871. [Q6N043-4]
    ENST00000558320; ENSP00000453706; ENSG00000137871. [Q6N043-6]
    ENST00000559237; ENSP00000454111; ENSG00000137871. [Q6N043-2]
    ENST00000560002; ENSP00000453636; ENSG00000137871. [Q6N043-3]
    GeneIDi54816.
    KEGGihsa:54816.
    UCSCiuc002adt.3. human. [Q6N043-5]
    uc002adu.3. human. [Q6N043-1]

    Polymorphism databases

    DMDMi223634726.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB046804 mRNA. Translation: BAB13410.1 . Different initiation.
    AK000093 mRNA. Translation: BAA90940.1 .
    AL136634 mRNA. Translation: CAB66569.1 .
    BX640637 mRNA. Translation: CAE45785.1 .
    BX640707 mRNA. Translation: CAE45827.1 .
    BX641000 mRNA. Translation: CAE46003.1 . Different initiation.
    AC010999 Genomic DNA. No translation available.
    AC090517 Genomic DNA. No translation available.
    AC090518 Genomic DNA. No translation available.
    BC015382 mRNA. Translation: AAH15382.2 .
    BC053649 mRNA. Translation: AAH53649.2 .
    BC064359 mRNA. Translation: AAH64359.1 .
    BC130451 mRNA. Translation: AAI30452.1 .
    BC136412 mRNA. Translation: AAI36413.1 .
    CCDSi CCDS32245.1. [Q6N043-1 ]
    CCDS42041.1. [Q6N043-2 ]
    CCDS58364.1. [Q6N043-6 ]
    RefSeqi NP_001002843.1. NM_001002843.2. [Q6N043-2 ]
    NP_001002844.1. NM_001002844.2. [Q6N043-6 ]
    NP_001275517.1. NM_001288588.1. [Q6N043-1 ]
    NP_001275518.1. NM_001288589.1. [Q6N043-6 ]
    NP_060131.2. NM_017661.3. [Q6N043-1 ]
    UniGenei Hs.511477.

    3D structure databases

    ProteinModelPortali Q6N043.
    SMRi Q6N043. Positions 320-497, 644-676.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120173. 5 interactions.
    IntActi Q6N043. 2 interactions.
    MINTi MINT-4716449.
    STRINGi 9606.ENSP00000267807.

    PTM databases

    PhosphoSitei Q6N043.

    Polymorphism databases

    DMDMi 223634726.

    Proteomic databases

    MaxQBi Q6N043.
    PaxDbi Q6N043.
    PRIDEi Q6N043.

    Protocols and materials databases

    DNASUi 54816.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000267807 ; ENSP00000267807 ; ENSG00000137871 . [Q6N043-1 ]
    ENST00000558067 ; ENSP00000454173 ; ENSG00000137871 . [Q6N043-4 ]
    ENST00000558320 ; ENSP00000453706 ; ENSG00000137871 . [Q6N043-6 ]
    ENST00000559237 ; ENSP00000454111 ; ENSG00000137871 . [Q6N043-2 ]
    ENST00000560002 ; ENSP00000453636 ; ENSG00000137871 . [Q6N043-3 ]
    GeneIDi 54816.
    KEGGi hsa:54816.
    UCSCi uc002adt.3. human. [Q6N043-5 ]
    uc002adu.3. human. [Q6N043-1 ]

    Organism-specific databases

    CTDi 54816.
    GeneCardsi GC15M056922.
    HGNCi HGNC:25953. ZNF280D.
    HPAi HPA030233.
    neXtProti NX_Q6N043.
    PharmGKBi PA162410004.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG239493.
    HOVERGENi HBG060885.
    InParanoidi Q6N043.
    OMAi HYQGGPT.
    OrthoDBi EOG7QVM24.
    PhylomeDBi Q6N043.
    TreeFami TF331707.

    Miscellaneous databases

    GeneWikii SUHW4.
    GenomeRNAii 54816.
    NextBioi 57557.
    PROi Q6N043.

    Gene expression databases

    ArrayExpressi Q6N043.
    Bgeei Q6N043.
    CleanExi HS_ZNF280D.
    Genevestigatori Q6N043.

    Family and domain databases

    InterProi IPR025243. DUF4195.
    IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    [Graphical view ]
    Pfami PF13836. DUF4195. 1 hit.
    [Graphical view ]
    SMARTi SM00355. ZnF_C2H2. 9 hits.
    [Graphical view ]
    PROSITEi PS00028. ZINC_FINGER_C2H2_1. 5 hits.
    PS50157. ZINC_FINGER_C2H2_2. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.
      DNA Res. 7:273-281(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ILE-568.
      Tissue: Brain.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
      Tissue: Brain.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), VARIANT ILE-568.
      Tissue: Colon.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3), VARIANT ILE-568.
      Tissue: Colon endothelium, Liver and Uterine endothelium.
    5. "Analysis of the DNA sequence and duplication history of human chromosome 15."
      Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
      , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
      Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 6), VARIANT ILE-568.
      Tissue: Brain, Liver, Skin and Uterus.
    7. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
      Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
      J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-545, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-545, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-104, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.

    Entry informationi

    Entry nameiZ280D_HUMAN
    AccessioniPrimary (citable) accession number: Q6N043
    Secondary accession number(s): A1L495
    , B2RMT6, Q6MZM6, Q6N085, Q6P2R6, Q7Z6J5, Q9H0U5, Q9HCI8, Q9NXS0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 21, 2006
    Last sequence update: February 10, 2009
    Last modified: October 1, 2014
    This is version 102 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 15
      Human chromosome 15: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3