Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Actin-binding LIM protein 2

Gene

Ablim2

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

May act as scaffold protein. May stimulate ABRA activity and ABRA-dependent SRF transcriptional activity (By similarity).By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi83 – 831Zinc 1By similarity
Metal bindingi86 – 861Zinc 1By similarity
Metal bindingi103 – 1031Zinc 1By similarity
Metal bindingi106 – 1061Zinc 1By similarity
Metal bindingi109 – 1091Zinc 2By similarity
Metal bindingi112 – 1121Zinc 2By similarity
Metal bindingi131 – 1311Zinc 2By similarity
Metal bindingi134 – 1341Zinc 2By similarity
Metal bindingi212 – 2121Zinc 3By similarity
Metal bindingi215 – 2151Zinc 3By similarity
Metal bindingi232 – 2321Zinc 3By similarity
Metal bindingi235 – 2351Zinc 3By similarity
Metal bindingi238 – 2381Zinc 4By similarity
Metal bindingi241 – 2411Zinc 4By similarity
Metal bindingi260 – 2601Zinc 4By similarity
Metal bindingi263 – 2631Zinc 4By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Actin-binding LIM protein 2
Short name:
abLIM-2
Alternative name(s):
Actin-binding LIM protein family member 2
Gene namesi
Name:Ablim2
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi1303094. Ablim2.

Subcellular locationi

  • Cytoplasm

  • Note: In skeletal muscle, sarcomeric or cosarcomeric localization.By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 612612Actin-binding LIM protein 2PRO_0000075701Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei282 – 2821PhosphoserineCombined sources
Modified residuei294 – 2941PhosphoserineBy similarity
Modified residuei365 – 3651PhosphoserineCombined sources
Modified residuei368 – 3681PhosphoserineBy similarity
Modified residuei453 – 4531PhosphoserineCombined sources
Modified residuei473 – 4731PhosphothreonineBy similarity
Modified residuei477 – 4771PhosphoserineCombined sources
Modified residuei579 – 5791PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ6KC51.
PRIDEiQ6KC51.

PTM databases

iPTMnetiQ6KC51.
SwissPalmiQ6KC51.

Expressioni

Gene expression databases

GenevisibleiQ6KC51. RN.

Interactioni

Subunit structurei

Interacts with F-actin and ABRA.By similarity

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000055116.

Structurei

3D structure databases

ProteinModelPortaliQ6KC51.
SMRiQ6KC51. Positions 74-140, 148-209, 212-271, 541-612.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini22 – 8160LIM zinc-binding 1PROSITE-ProRule annotationAdd
BLAST
Domaini81 – 14161LIM zinc-binding 2PROSITE-ProRule annotationAdd
BLAST
Domaini151 – 21060LIM zinc-binding 3PROSITE-ProRule annotationAdd
BLAST
Domaini210 – 27061LIM zinc-binding 4PROSITE-ProRule annotationAdd
BLAST
Domaini544 – 61269HPPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi364 – 41249Ser-richAdd
BLAST

Sequence similaritiesi

Contains 1 HP (headpiece) domain.PROSITE-ProRule annotation
Contains 4 LIM zinc-binding domains.PROSITE-ProRule annotation

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

eggNOGiKOG1044. Eukaryota.
ENOG410XRPY. LUCA.
HOGENOMiHOG000285997.
HOVERGENiHBG031499.
InParanoidiQ6KC51.
KOiK07520.
OMAiEIKNGQS.
OrthoDBiEOG71CFKF.

Family and domain databases

Gene3Di1.10.950.10. 1 hit.
2.10.110.10. 4 hits.
InterProiIPR028450. ABLIM2.
IPR032402. AbLIM_anchor.
IPR003128. Villin_headpiece.
IPR001781. Znf_LIM.
[Graphical view]
PANTHERiPTHR24213:SF6. PTHR24213:SF6. 1 hit.
PfamiPF16182. AbLIM_anchor. 2 hits.
PF00412. LIM. 4 hits.
PF02209. VHP. 1 hit.
[Graphical view]
SMARTiSM00132. LIM. 4 hits.
SM00153. VHP. 1 hit.
[Graphical view]
SUPFAMiSSF47050. SSF47050. 1 hit.
PROSITEiPS51089. HP. 1 hit.
PS00478. LIM_DOMAIN_1. 4 hits.
PS50023. LIM_DOMAIN_2. 4 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6KC51-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSAVSQPQAA HAPLEKPAST AILCNTCGNV CKGEVLRVQN KHFHIRCFVC
60 70 80 90 100
KACGCDLAEG GFFVRQGEHI CTRDYQRLYG TRCFSCDCFI EGEVVSALGK
110 120 130 140 150
TYHPDCFVCA VCRLPFPPGD RVTFNGKDCM CQKCSPPTLV GNSAHVAQGL
160 170 180 190 200
RSCGGCGLEI KNGQALVALD KHWHLGCFKC KTCGKLLNAE YISKDGLPYC
210 220 230 240 250
EADYHTKFGI RCDGCEKYIT GRVLEAGEKH YHPSCALCVR CGQMFSEGEE
260 270 280 290 300
MYLQGSSIWH PACRQAARTE DKSKETRTSS ESIVSVPASS TSGSPSRVIY
310 320 330 340 350
AKLGDEILDY RDLAALPKNK AIYNIDRPDM ISYSPYISHS AVGDRQSYGE
360 370 380 390 400
GDQDDRSYKQ CRTSSPSSAG SVSLGHYTPT SRSPQHYSRP GSESGRSTPS
410 420 430 440 450
LSVHSDSRPP SSTYQQAPRH FHVPDTGVKD NIYRKPPIYK QHAARRLDVE
460 470 480 490 500
DSSFDQDSRK KTTWLLLKGD ADTRTNSPDL DSQSLSLSSG ADQEPLQRMP
510 520 530 540 550
GDSLYSRFPY SKPDTLPGPR KDGLDLRNAN LAPCGADPDA SWGTREYKIY
560 570 580 590 600
PYDSLIVTNR IRVKLPKDVD RTRLERHLSP EEFQEVFGMS IEEFDRLALW
610
KRNDLKKKAL LF
Length:612
Mass (Da):68,010
Last modified:July 5, 2004 - v1
Checksum:iB6B6E27365D00B26
GO
Isoform 2 (identifier: Q6KC51-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     507-546: RFPYSKPDTLPGPRKDGLDLRNANLAPCGADPDASWGTRE → Q

Show »
Length:573
Mass (Da):63,800
Checksum:i5C9C8C775682FB66
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei507 – 54640RFPYS…WGTRE → Q in isoform 2. 1 PublicationVSP_012125Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ703892 mRNA. Translation: CAG28314.1.
AJ703893 mRNA. Translation: CAG28315.1.
RefSeqiNP_001001514.1. NM_001001514.2. [Q6KC51-2]
NP_001171166.1. NM_001177695.1. [Q6KC51-1]
UniGeneiRn.131797.

Genome annotation databases

GeneIDi360958.
KEGGirno:360958.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ703892 mRNA. Translation: CAG28314.1.
AJ703893 mRNA. Translation: CAG28315.1.
RefSeqiNP_001001514.1. NM_001001514.2. [Q6KC51-2]
NP_001171166.1. NM_001177695.1. [Q6KC51-1]
UniGeneiRn.131797.

3D structure databases

ProteinModelPortaliQ6KC51.
SMRiQ6KC51. Positions 74-140, 148-209, 212-271, 541-612.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000055116.

PTM databases

iPTMnetiQ6KC51.
SwissPalmiQ6KC51.

Proteomic databases

PaxDbiQ6KC51.
PRIDEiQ6KC51.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi360958.
KEGGirno:360958.

Organism-specific databases

CTDi84448.
RGDi1303094. Ablim2.

Phylogenomic databases

eggNOGiKOG1044. Eukaryota.
ENOG410XRPY. LUCA.
HOGENOMiHOG000285997.
HOVERGENiHBG031499.
InParanoidiQ6KC51.
KOiK07520.
OMAiEIKNGQS.
OrthoDBiEOG71CFKF.

Miscellaneous databases

PROiQ6KC51.

Gene expression databases

GenevisibleiQ6KC51. RN.

Family and domain databases

Gene3Di1.10.950.10. 1 hit.
2.10.110.10. 4 hits.
InterProiIPR028450. ABLIM2.
IPR032402. AbLIM_anchor.
IPR003128. Villin_headpiece.
IPR001781. Znf_LIM.
[Graphical view]
PANTHERiPTHR24213:SF6. PTHR24213:SF6. 1 hit.
PfamiPF16182. AbLIM_anchor. 2 hits.
PF00412. LIM. 4 hits.
PF02209. VHP. 1 hit.
[Graphical view]
SMARTiSM00132. LIM. 4 hits.
SM00153. VHP. 1 hit.
[Graphical view]
SUPFAMiSSF47050. SSF47050. 1 hit.
PROSITEiPS51089. HP. 1 hit.
PS00478. LIM_DOMAIN_1. 4 hits.
PS50023. LIM_DOMAIN_2. 4 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Structure and transcriptional activity of the ABLIM2 gene of human, mouse and rat."
    Klimov E.A., Rakhmanaliev E.R., Rudco O.I.
    Submitted (APR-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    Strain: Wistar.
  2. "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues."
    Lundby A., Secher A., Lage K., Nordsborg N.B., Dmytriyev A., Lundby C., Olsen J.V.
    Nat. Commun. 3:876-876(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-282; SER-365; SER-453; SER-477 AND SER-579, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiABLM2_RAT
AccessioniPrimary (citable) accession number: Q6KC51
Secondary accession number(s): Q6KC50
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 7, 2004
Last sequence update: July 5, 2004
Last modified: June 8, 2016
This is version 95 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.