Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6KB66

- K2C80_HUMAN

UniProt

Q6KB66 - K2C80_HUMAN

Protein

Keratin, type II cytoskeletal 80

Gene

KRT80

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 86 (01 Oct 2014)
      Sequence version 2 (15 Jan 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei334 – 3341Stutter

    GO - Molecular functioni

    1. structural molecule activity Source: InterPro

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Keratin, type II cytoskeletal 80
    Alternative name(s):
    Cytokeratin-80
    Short name:
    CK-80
    Keratin-80
    Short name:
    K80
    Type-II keratin Kb20
    Gene namesi
    Name:KRT80
    Synonyms:KB20
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:27056. KRT80.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasm Source: UniProt
    2. intermediate filament Source: UniProt
    3. keratin filament Source: InterPro

    Keywords - Cellular componenti

    Intermediate filament, Keratin

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA147357831.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 452452Keratin, type II cytoskeletal 80PRO_0000314896Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei45 – 451Phosphoserine1 Publication
    Modified residuei396 – 3961Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ6KB66.
    PaxDbiQ6KB66.
    PRIDEiQ6KB66.

    PTM databases

    PhosphoSiteiQ6KB66.

    Expressioni

    Tissue specificityi

    Weakly expressed in tongue, but not skin or in any other tissues or organs examined.1 Publication

    Gene expression databases

    BgeeiQ6KB66.
    CleanExiHS_KRT80.
    GenevestigatoriQ6KB66.

    Organism-specific databases

    HPAiHPA040782.

    Interactioni

    Subunit structurei

    Heterotetramer of two type I and two type II keratins.

    Protein-protein interaction databases

    BioGridi126858. 3 interactions.
    IntActiQ6KB66. 1 interaction.
    STRINGi9606.ENSP00000378292.

    Structurei

    3D structure databases

    ProteinModelPortaliQ6KB66.
    SMRiQ6KB66. Positions 128-230, 295-389.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1 – 8282HeadAdd
    BLAST
    Regioni82 – 11837Coil 1AAdd
    BLAST
    Regioni83 – 390308RodAdd
    BLAST
    Regioni119 – 13517Linker 1Add
    BLAST
    Regioni136 – 22792Coil 1BAdd
    BLAST
    Regioni228 – 25124Linker 12Add
    BLAST
    Regioni252 – 390139Coil 2Add
    BLAST
    Regioni391 – 45262TailAdd
    BLAST

    Sequence similaritiesi

    Belongs to the intermediate filament family.Curated

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiNOG147372.
    HOGENOMiHOG000230976.
    HOVERGENiHBG013015.
    KOiK07605.
    OMAiSCEVTPV.
    OrthoDBiEOG7FV3Q8.
    PhylomeDBiQ6KB66.
    TreeFamiTF317854.

    Family and domain databases

    InterProiIPR001664. IF.
    IPR003054. Keratin_II.
    [Graphical view]
    PANTHERiPTHR23239. PTHR23239. 1 hit.
    PfamiPF00038. Filament. 1 hit.
    [Graphical view]
    PRINTSiPR01276. TYPE2KERATIN.

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6KB66-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MACRSCVVGF SSLSSCEVTP VGSPRPGTSG WDSCRAPGPG FSSRSLTGCW    50
    SAGTISKVTV NPGLLVPLDV KLDPAVQQLK NQEKEEMKAL NDKFASLIGK 100
    VQALEQRNQL LETRWSFLQG QDSAIFDLGH LYEEYQGRLQ EELRKVSQER 150
    GQLEANLLQV LEKVEEFRIR YEDEISKRTD MEFTFVQLKK DLDAECLHRT 200
    ELETKLKSLE SFVELMKTIY EQELKDLAAQ VKDVSVTVGM DSRCHIDLSG 250
    IVEEVKAQYD AVAARSLEEA EAYSRSQLEE QAARSAEYGS SLQSSRSEIA 300
    DLNVRIQKLR SQILSVKSHC LKLEENIKTA EEQGELAFQD AKTKLAQLEA 350
    ALQQAKQDMA RQLRKYQELM NVKLALDIEI ATYRKLVEGE EGRMDSPSAT 400
    VVSAVQSRCK TAASRSGLSK APSRKKKGSK GPVIKITEMS EKYFSQESEV 450
    SE 452
    Length:452
    Mass (Da):50,525
    Last modified:January 15, 2008 - v2
    Checksum:iBC54C53D0566FEA3
    GO
    Isoform 2 (identifier: Q6KB66-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         413-452: ASRSGLSKAPSRKKKGSKGPVIKITEMSEKYFSQESEVSE → PSLPYPLCSL

    Show »
    Length:422
    Mass (Da):47,242
    Checksum:i0ACF1622662D27E2
    GO
    Isoform 3 (identifier: Q6KB66-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-100: MACRSCVVGF...NDKFASLIGK → MSCHFPGSPP...DPFAAFLLSQ
         190-190: K → KVACPACPRG...PTTHHCCQPQ

    Note: No experimental confirmation available.

    Show »
    Length:487
    Mass (Da):54,176
    Checksum:iDF0C64CD3A800AF6
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti230 – 2301Q → L in CAG30732. (PubMed:15737194)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti238 – 2381V → I.
    Corresponds to variant rs35725856 [ dbSNP | Ensembl ].
    VAR_049807

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 100100MACRS…SLIGK → MSCHFPGSPPWALAGQPGAS APDWSTPDPFAAFLLSQ in isoform 3. 1 PublicationVSP_030421Add
    BLAST
    Alternative sequencei190 – 1901K → KVACPACPRGSFLMGPGPSF PPDILLSFMPNQSPQRLKSQ DQQTDRGIPPSPSSSFFEAL SQISSGITPTLTQEAAPQPT PALGPSIPSPTTHHCCQPQ in isoform 3. 1 PublicationVSP_030422
    Alternative sequencei413 – 45240ASRSG…SEVSE → PSLPYPLCSL in isoform 2. 1 PublicationVSP_030423Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ717743 mRNA. Translation: CAG30732.1.
    BX537567 mRNA. Translation: CAD97784.1.
    CH471111 Genomic DNA. Translation: EAW58237.1.
    BC065180 mRNA. Translation: AAH65180.1.
    CCDSiCCDS41784.1. [Q6KB66-2]
    CCDS8821.2. [Q6KB66-1]
    RefSeqiNP_001074961.1. NM_001081492.1. [Q6KB66-2]
    NP_872313.2. NM_182507.2. [Q6KB66-1]
    UniGeneiHs.140978.

    Genome annotation databases

    EnsembliENST00000313234; ENSP00000369361; ENSG00000167767. [Q6KB66-2]
    ENST00000394815; ENSP00000378292; ENSG00000167767. [Q6KB66-1]
    GeneIDi144501.
    KEGGihsa:144501.
    UCSCiuc001rzw.3. human. [Q6KB66-3]
    uc001rzx.3. human. [Q6KB66-1]
    uc001rzy.3. human. [Q6KB66-2]

    Polymorphism databases

    DMDMi166218808.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ717743 mRNA. Translation: CAG30732.1 .
    BX537567 mRNA. Translation: CAD97784.1 .
    CH471111 Genomic DNA. Translation: EAW58237.1 .
    BC065180 mRNA. Translation: AAH65180.1 .
    CCDSi CCDS41784.1. [Q6KB66-2 ]
    CCDS8821.2. [Q6KB66-1 ]
    RefSeqi NP_001074961.1. NM_001081492.1. [Q6KB66-2 ]
    NP_872313.2. NM_182507.2. [Q6KB66-1 ]
    UniGenei Hs.140978.

    3D structure databases

    ProteinModelPortali Q6KB66.
    SMRi Q6KB66. Positions 128-230, 295-389.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 126858. 3 interactions.
    IntActi Q6KB66. 1 interaction.
    STRINGi 9606.ENSP00000378292.

    PTM databases

    PhosphoSitei Q6KB66.

    Polymorphism databases

    DMDMi 166218808.

    Proteomic databases

    MaxQBi Q6KB66.
    PaxDbi Q6KB66.
    PRIDEi Q6KB66.

    Protocols and materials databases

    DNASUi 144501.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000313234 ; ENSP00000369361 ; ENSG00000167767 . [Q6KB66-2 ]
    ENST00000394815 ; ENSP00000378292 ; ENSG00000167767 . [Q6KB66-1 ]
    GeneIDi 144501.
    KEGGi hsa:144501.
    UCSCi uc001rzw.3. human. [Q6KB66-3 ]
    uc001rzx.3. human. [Q6KB66-1 ]
    uc001rzy.3. human. [Q6KB66-2 ]

    Organism-specific databases

    CTDi 144501.
    GeneCardsi GC12M052562.
    HGNCi HGNC:27056. KRT80.
    HPAi HPA040782.
    MIMi 611161. gene.
    neXtProti NX_Q6KB66.
    PharmGKBi PA147357831.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG147372.
    HOGENOMi HOG000230976.
    HOVERGENi HBG013015.
    KOi K07605.
    OMAi SCEVTPV.
    OrthoDBi EOG7FV3Q8.
    PhylomeDBi Q6KB66.
    TreeFami TF317854.

    Miscellaneous databases

    GeneWikii KRT80.
    GenomeRNAii 144501.
    NextBioi 84945.
    PROi Q6KB66.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q6KB66.
    CleanExi HS_KRT80.
    Genevestigatori Q6KB66.

    Family and domain databases

    InterProi IPR001664. IF.
    IPR003054. Keratin_II.
    [Graphical view ]
    PANTHERi PTHR23239. PTHR23239. 1 hit.
    Pfami PF00038. Filament. 1 hit.
    [Graphical view ]
    PRINTSi PR01276. TYPE2KERATIN.
    ProtoNeti Search...

    Publicationsi

    1. "Characterization of new members of the human type II keratin gene family and a general evaluation of the keratin gene domain on chromosome 12q13.13."
      Rogers M.A., Edler L., Winter H., Langbein L., Beckmann I., Schweizer J.
      J. Invest. Dermatol. 124:536-544(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
      Tissue: Scalp.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Endometrial adenocarcinoma.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Prostate.
    5. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
      Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
      Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-45 AND SER-396, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiK2C80_HUMAN
    AccessioniPrimary (citable) accession number: Q6KB66
    Secondary accession number(s): Q6P1A5, Q7Z3Q0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 15, 2008
    Last sequence update: January 15, 2008
    Last modified: October 1, 2014
    This is version 86 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    There are two types of cytoskeletal and microfibrillar keratin, I (acidic) and II (neutral to basic) (40-55 and 56-70 kDa, respectively).

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3