Q6KB66 (K2C80_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 73.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Keratin, type II cytoskeletal 80 Alternative name(s): Cytokeratin-80 Short name=CK-80 Keratin-80 Short name=K80 Type-II keratin Kb20 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 452 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subunit structure | Heterotetramer of two type I and two type II keratins. |
| Tissue specificity | Weakly expressed in tongue, but not skin or in any other tissues or organs examined. Ref.1 |
| Miscellaneous | There are two types of cytoskeletal and microfibrillar keratin, I (acidic) and II (neutral to basic) (40-55 and 56-70 kDa, respectively). |
| Sequence similarities | Belongs to the intermediate filament family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Intermediate filament Keratin |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | keratin filament Inferred from electronic annotation. Source: InterPro |
| Molecular_function | structural molecule activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6KB66-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6KB66-2) The sequence of this isoform differs from the canonical sequence as follows: 413-452: ASRSGLSKAPSRKKKGSKGPVIKITEMSEKYFSQESEVSE → PSLPYPLCSL | ||||||
| Isoform 3 (identifier: Q6KB66-3) The sequence of this isoform differs from the canonical sequence as follows: 1-100: MACRSCVVGF...NDKFASLIGK → MSCHFPGSPP...DPFAAFLLSQ 190-190: K → KVACPACPRG...PTTHHCCQPQ | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 452 | 452 | Keratin, type II cytoskeletal 80 | PRO_0000314896 | |||||
Regions | |||||||||
| Region | 1 – 82 | 82 | Head | ||||||
| Region | 82 – 118 | 37 | Coil 1A | ||||||
| Region | 83 – 390 | 308 | Rod | ||||||
| Region | 119 – 135 | 17 | Linker 1 | ||||||
| Region | 136 – 227 | 92 | Coil 1B | ||||||
| Region | 228 – 251 | 24 | Linker 12 | ||||||
| Region | 252 – 390 | 139 | Coil 2 | ||||||
| Region | 391 – 452 | 62 | Tail | ||||||
Sites | |||||||||
| Site | 334 | 1 | Stutter | ||||||
Amino acid modifications | |||||||||
| Modified residue | 45 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 396 | 1 | Phosphoserine Ref.6 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 100 | 100 | MACRS…SLIGK → MSCHFPGSPPWALAGQPGAS APDWSTPDPFAAFLLSQ in isoform 3. | VSP_030421 | |||||
| Alternative sequence | 190 | 1 | K → KVACPACPRGSFLMGPGPSF PPDILLSFMPNQSPQRLKSQ DQQTDRGIPPSPSSSFFEAL SQISSGITPTLTQEAAPQPT PALGPSIPSPTTHHCCQPQ in isoform 3. | VSP_030422 | |||||
| Alternative sequence | 413 – 452 | 40 | ASRSG…SEVSE → PSLPYPLCSL in isoform 2. | VSP_030423 | |||||
| Natural variant | 238 | 1 | V → I. Corresponds to variant rs35725856 [ dbSNP | Ensembl ]. | VAR_049807 | |||||
Experimental info | |||||||||
| Sequence conflict | 230 | 1 | Q → L in CAG30732. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization of new members of the human type II keratin gene family and a general evaluation of the keratin gene domain on chromosome 12q13.13." Rogers M.A., Edler L., Winter H., Langbein L., Beckmann I., Schweizer J. J. Invest. Dermatol. 124:536-544(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. Tissue: Scalp. |
| [2] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Endometrial adenocarcinoma. |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Prostate. |
| [5] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [6] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-45 AND SER-396, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [7] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ717743 mRNA. Translation: CAG30732.1. BX537567 mRNA. Translation: CAD97784.1. CH471111 Genomic DNA. Translation: EAW58237.1. BC065180 mRNA. Translation: AAH65180.1. |
| IPI | IPI00375843. IPI00431749. IPI00853265. |
| RefSeq | NP_001074961.1. NM_001081492.1. NP_872313.2. NM_182507.2. |
| UniGene | Hs.140978. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1GK4 based on UniProtKB P08670. |
| ProteinModelPortal | Q6KB66. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q6KB66. 1 interaction. |
| STRING | 9606.ENSP00000378292. |
PTM databases | |
| PhosphoSite | Q6KB66. |
Polymorphism databases | |
| DMDM | 166218808. |
Proteomic databases | |
| PaxDb | Q6KB66. |
| PRIDE | Q6KB66. |
Protocols and materials databases | |
| DNASU | 144501. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000313234; ENSP00000369361; ENSG00000167767. ENST00000394815; ENSP00000378292; ENSG00000167767. |
| GeneID | 144501. |
| KEGG | hsa:144501. |
| UCSC | uc001rzw.3. human. uc001rzx.3. human. uc001rzy.3. human. |
Organism-specific databases | |
| CTD | 144501. |
| GeneCards | GC12M052562. |
| HGNC | HGNC:27056. KRT80. |
| HPA | HPA040782. |
| MIM | 611161. gene. |
| neXtProt | NX_Q6KB66. |
| PharmGKB | PA147357831. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG147372. |
| HOGENOM | HOG000230976. |
| HOVERGEN | HBG013015. |
| KO | K07605. |
| OMA | NQEKEEM. |
Gene expression databases | |
| Bgee | Q6KB66. |
| CleanEx | HS_KRT80. |
| Genevestigator | Q6KB66. |
Family and domain databases | |
| InterPro | IPR016044. F. IPR001664. IF. IPR003054. Keratin_II. [Graphical view] |
| PANTHER | PTHR23239. PTHR23239. 1 hit. PTHR23239:SF18. PTHR23239:SF18. 1 hit. |
| Pfam | PF00038. Filament. 1 hit. [Graphical view] |
| PRINTS | PR01276. TYPE2KERATIN. |
| PROSITE | PS00226. IF. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 144501. |
| NextBio | 84945. |
| SOURCE | Search... |
Entry information
| Entry name | K2C80_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6KB66 Secondary accession number(s): Q6P1A5, Q7Z3Q0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
