Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6KB66

- K2C80_HUMAN

UniProt

Q6KB66 - K2C80_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Keratin, type II cytoskeletal 80

Gene

KRT80

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei334 – 3341Stutter

GO - Molecular functioni

  1. structural molecule activity Source: InterPro
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Keratin, type II cytoskeletal 80
Alternative name(s):
Cytokeratin-80
Short name:
CK-80
Keratin-80
Short name:
K80
Type-II keratin Kb20
Gene namesi
Name:KRT80
Synonyms:KB20
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:27056. KRT80.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: UniProt
  2. intermediate filament Source: UniProt
  3. keratin filament Source: InterPro
Complete GO annotation...

Keywords - Cellular componenti

Intermediate filament, Keratin

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA147357831.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 452452Keratin, type II cytoskeletal 80PRO_0000314896Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei45 – 451Phosphoserine1 Publication
Modified residuei396 – 3961Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ6KB66.
PaxDbiQ6KB66.
PRIDEiQ6KB66.

PTM databases

PhosphoSiteiQ6KB66.

Expressioni

Tissue specificityi

Weakly expressed in tongue, but not skin or in any other tissues or organs examined.1 Publication

Gene expression databases

BgeeiQ6KB66.
CleanExiHS_KRT80.
GenevestigatoriQ6KB66.

Organism-specific databases

HPAiHPA040782.

Interactioni

Subunit structurei

Heterotetramer of two type I and two type II keratins.

Protein-protein interaction databases

BioGridi126858. 3 interactions.
IntActiQ6KB66. 1 interaction.
STRINGi9606.ENSP00000378292.

Structurei

3D structure databases

ProteinModelPortaliQ6KB66.
SMRiQ6KB66. Positions 128-230, 295-389.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 8282HeadAdd
BLAST
Regioni82 – 11837Coil 1AAdd
BLAST
Regioni83 – 390308RodAdd
BLAST
Regioni119 – 13517Linker 1Add
BLAST
Regioni136 – 22792Coil 1BAdd
BLAST
Regioni228 – 25124Linker 12Add
BLAST
Regioni252 – 390139Coil 2Add
BLAST
Regioni391 – 45262TailAdd
BLAST

Sequence similaritiesi

Belongs to the intermediate filament family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG147372.
GeneTreeiENSGT00730000110415.
HOGENOMiHOG000230976.
HOVERGENiHBG013015.
InParanoidiQ6KB66.
KOiK07605.
OMAiSCEVTPV.
OrthoDBiEOG7FV3Q8.
PhylomeDBiQ6KB66.
TreeFamiTF317854.

Family and domain databases

InterProiIPR001664. IF.
IPR003054. Keratin_II.
[Graphical view]
PANTHERiPTHR23239. PTHR23239. 1 hit.
PfamiPF00038. Filament. 1 hit.
[Graphical view]
PRINTSiPR01276. TYPE2KERATIN.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6KB66-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MACRSCVVGF SSLSSCEVTP VGSPRPGTSG WDSCRAPGPG FSSRSLTGCW
60 70 80 90 100
SAGTISKVTV NPGLLVPLDV KLDPAVQQLK NQEKEEMKAL NDKFASLIGK
110 120 130 140 150
VQALEQRNQL LETRWSFLQG QDSAIFDLGH LYEEYQGRLQ EELRKVSQER
160 170 180 190 200
GQLEANLLQV LEKVEEFRIR YEDEISKRTD MEFTFVQLKK DLDAECLHRT
210 220 230 240 250
ELETKLKSLE SFVELMKTIY EQELKDLAAQ VKDVSVTVGM DSRCHIDLSG
260 270 280 290 300
IVEEVKAQYD AVAARSLEEA EAYSRSQLEE QAARSAEYGS SLQSSRSEIA
310 320 330 340 350
DLNVRIQKLR SQILSVKSHC LKLEENIKTA EEQGELAFQD AKTKLAQLEA
360 370 380 390 400
ALQQAKQDMA RQLRKYQELM NVKLALDIEI ATYRKLVEGE EGRMDSPSAT
410 420 430 440 450
VVSAVQSRCK TAASRSGLSK APSRKKKGSK GPVIKITEMS EKYFSQESEV

SE
Length:452
Mass (Da):50,525
Last modified:January 15, 2008 - v2
Checksum:iBC54C53D0566FEA3
GO
Isoform 2 (identifier: Q6KB66-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     413-452: ASRSGLSKAPSRKKKGSKGPVIKITEMSEKYFSQESEVSE → PSLPYPLCSL

Show »
Length:422
Mass (Da):47,242
Checksum:i0ACF1622662D27E2
GO
Isoform 3 (identifier: Q6KB66-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-100: MACRSCVVGF...NDKFASLIGK → MSCHFPGSPP...DPFAAFLLSQ
     190-190: K → KVACPACPRG...PTTHHCCQPQ

Note: No experimental confirmation available.

Show »
Length:487
Mass (Da):54,176
Checksum:iDF0C64CD3A800AF6
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti230 – 2301Q → L in CAG30732. (PubMed:15737194)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti238 – 2381V → I.
Corresponds to variant rs35725856 [ dbSNP | Ensembl ].
VAR_049807

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 100100MACRS…SLIGK → MSCHFPGSPPWALAGQPGAS APDWSTPDPFAAFLLSQ in isoform 3. 1 PublicationVSP_030421Add
BLAST
Alternative sequencei190 – 1901K → KVACPACPRGSFLMGPGPSF PPDILLSFMPNQSPQRLKSQ DQQTDRGIPPSPSSSFFEAL SQISSGITPTLTQEAAPQPT PALGPSIPSPTTHHCCQPQ in isoform 3. 1 PublicationVSP_030422
Alternative sequencei413 – 45240ASRSG…SEVSE → PSLPYPLCSL in isoform 2. 1 PublicationVSP_030423Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ717743 mRNA. Translation: CAG30732.1.
BX537567 mRNA. Translation: CAD97784.1.
CH471111 Genomic DNA. Translation: EAW58237.1.
BC065180 mRNA. Translation: AAH65180.1.
CCDSiCCDS41784.1. [Q6KB66-2]
CCDS8821.2. [Q6KB66-1]
RefSeqiNP_001074961.1. NM_001081492.1. [Q6KB66-2]
NP_872313.2. NM_182507.2. [Q6KB66-1]
UniGeneiHs.140978.

Genome annotation databases

EnsembliENST00000313234; ENSP00000369361; ENSG00000167767. [Q6KB66-2]
ENST00000394815; ENSP00000378292; ENSG00000167767. [Q6KB66-1]
GeneIDi144501.
KEGGihsa:144501.
UCSCiuc001rzw.3. human. [Q6KB66-3]
uc001rzx.3. human. [Q6KB66-1]
uc001rzy.3. human. [Q6KB66-2]

Polymorphism databases

DMDMi166218808.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ717743 mRNA. Translation: CAG30732.1 .
BX537567 mRNA. Translation: CAD97784.1 .
CH471111 Genomic DNA. Translation: EAW58237.1 .
BC065180 mRNA. Translation: AAH65180.1 .
CCDSi CCDS41784.1. [Q6KB66-2 ]
CCDS8821.2. [Q6KB66-1 ]
RefSeqi NP_001074961.1. NM_001081492.1. [Q6KB66-2 ]
NP_872313.2. NM_182507.2. [Q6KB66-1 ]
UniGenei Hs.140978.

3D structure databases

ProteinModelPortali Q6KB66.
SMRi Q6KB66. Positions 128-230, 295-389.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 126858. 3 interactions.
IntActi Q6KB66. 1 interaction.
STRINGi 9606.ENSP00000378292.

PTM databases

PhosphoSitei Q6KB66.

Polymorphism databases

DMDMi 166218808.

Proteomic databases

MaxQBi Q6KB66.
PaxDbi Q6KB66.
PRIDEi Q6KB66.

Protocols and materials databases

DNASUi 144501.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000313234 ; ENSP00000369361 ; ENSG00000167767 . [Q6KB66-2 ]
ENST00000394815 ; ENSP00000378292 ; ENSG00000167767 . [Q6KB66-1 ]
GeneIDi 144501.
KEGGi hsa:144501.
UCSCi uc001rzw.3. human. [Q6KB66-3 ]
uc001rzx.3. human. [Q6KB66-1 ]
uc001rzy.3. human. [Q6KB66-2 ]

Organism-specific databases

CTDi 144501.
GeneCardsi GC12M052562.
HGNCi HGNC:27056. KRT80.
HPAi HPA040782.
MIMi 611161. gene.
neXtProti NX_Q6KB66.
PharmGKBi PA147357831.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG147372.
GeneTreei ENSGT00730000110415.
HOGENOMi HOG000230976.
HOVERGENi HBG013015.
InParanoidi Q6KB66.
KOi K07605.
OMAi SCEVTPV.
OrthoDBi EOG7FV3Q8.
PhylomeDBi Q6KB66.
TreeFami TF317854.

Miscellaneous databases

GeneWikii KRT80.
GenomeRNAii 144501.
NextBioi 84945.
PROi Q6KB66.
SOURCEi Search...

Gene expression databases

Bgeei Q6KB66.
CleanExi HS_KRT80.
Genevestigatori Q6KB66.

Family and domain databases

InterProi IPR001664. IF.
IPR003054. Keratin_II.
[Graphical view ]
PANTHERi PTHR23239. PTHR23239. 1 hit.
Pfami PF00038. Filament. 1 hit.
[Graphical view ]
PRINTSi PR01276. TYPE2KERATIN.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Characterization of new members of the human type II keratin gene family and a general evaluation of the keratin gene domain on chromosome 12q13.13."
    Rogers M.A., Edler L., Winter H., Langbein L., Beckmann I., Schweizer J.
    J. Invest. Dermatol. 124:536-544(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    Tissue: Scalp.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Endometrial adenocarcinoma.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Prostate.
  5. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-45 AND SER-396, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiK2C80_HUMAN
AccessioniPrimary (citable) accession number: Q6KB66
Secondary accession number(s): Q6P1A5, Q7Z3Q0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: January 15, 2008
Last modified: October 29, 2014
This is version 87 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

There are two types of cytoskeletal and microfibrillar keratin, I (acidic) and II (neutral to basic) (40-55 and 56-70 kDa, respectively).

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3