Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q6KB66 (K2C80_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 82. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Keratin, type II cytoskeletal 80
Alternative name(s):
Cytokeratin-80
Short name=CK-80
Keratin-80
Short name=K80
Type-II keratin Kb20
Gene names
Name:KRT80
Synonyms:KB20
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length452 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Subunit structure

Heterotetramer of two type I and two type II keratins.

Tissue specificity

Weakly expressed in tongue, but not skin or in any other tissues or organs examined. Ref.1

Miscellaneous

There are two types of cytoskeletal and microfibrillar keratin, I (acidic) and II (neutral to basic) (40-55 and 56-70 kDa, respectively).

Sequence similarities

Belongs to the intermediate filament family.

Ontologies

Keywords
   Cellular componentIntermediate filament
Keratin
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainCoiled coil
   PTMPhosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentkeratin filament

Inferred from electronic annotation. Source: InterPro

   Molecular_functionstructural molecule activity

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q6KB66-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q6KB66-2)

The sequence of this isoform differs from the canonical sequence as follows:
     413-452: ASRSGLSKAPSRKKKGSKGPVIKITEMSEKYFSQESEVSE → PSLPYPLCSL
Isoform 3 (identifier: Q6KB66-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-100: MACRSCVVGF...NDKFASLIGK → MSCHFPGSPP...DPFAAFLLSQ
     190-190: K → KVACPACPRG...PTTHHCCQPQ
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 452452Keratin, type II cytoskeletal 80
PRO_0000314896

Regions

Region1 – 8282Head
Region82 – 11837Coil 1A
Region83 – 390308Rod
Region119 – 13517Linker 1
Region136 – 22792Coil 1B
Region228 – 25124Linker 12
Region252 – 390139Coil 2
Region391 – 45262Tail

Sites

Site3341Stutter

Amino acid modifications

Modified residue451Phosphoserine Ref.6
Modified residue3961Phosphoserine Ref.6

Natural variations

Alternative sequence1 – 100100MACRS…SLIGK → MSCHFPGSPPWALAGQPGAS APDWSTPDPFAAFLLSQ in isoform 3.
VSP_030421
Alternative sequence1901K → KVACPACPRGSFLMGPGPSF PPDILLSFMPNQSPQRLKSQ DQQTDRGIPPSPSSSFFEAL SQISSGITPTLTQEAAPQPT PALGPSIPSPTTHHCCQPQ in isoform 3.
VSP_030422
Alternative sequence413 – 45240ASRSG…SEVSE → PSLPYPLCSL in isoform 2.
VSP_030423
Natural variant2381V → I.
Corresponds to variant rs35725856 [ dbSNP | Ensembl ].
VAR_049807

Experimental info

Sequence conflict2301Q → L in CAG30732. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified January 15, 2008. Version 2.
Checksum: BC54C53D0566FEA3

FASTA45250,525
        10         20         30         40         50         60 
MACRSCVVGF SSLSSCEVTP VGSPRPGTSG WDSCRAPGPG FSSRSLTGCW SAGTISKVTV 

        70         80         90        100        110        120 
NPGLLVPLDV KLDPAVQQLK NQEKEEMKAL NDKFASLIGK VQALEQRNQL LETRWSFLQG 

       130        140        150        160        170        180 
QDSAIFDLGH LYEEYQGRLQ EELRKVSQER GQLEANLLQV LEKVEEFRIR YEDEISKRTD 

       190        200        210        220        230        240 
MEFTFVQLKK DLDAECLHRT ELETKLKSLE SFVELMKTIY EQELKDLAAQ VKDVSVTVGM 

       250        260        270        280        290        300 
DSRCHIDLSG IVEEVKAQYD AVAARSLEEA EAYSRSQLEE QAARSAEYGS SLQSSRSEIA 

       310        320        330        340        350        360 
DLNVRIQKLR SQILSVKSHC LKLEENIKTA EEQGELAFQD AKTKLAQLEA ALQQAKQDMA 

       370        380        390        400        410        420 
RQLRKYQELM NVKLALDIEI ATYRKLVEGE EGRMDSPSAT VVSAVQSRCK TAASRSGLSK 

       430        440        450 
APSRKKKGSK GPVIKITEMS EKYFSQESEV SE 

« Hide

Isoform 2 [UniParc].

Checksum: 0ACF1622662D27E2
Show »

FASTA42247,242
Isoform 3 [UniParc].

Checksum: DF0C64CD3A800AF6
Show »

FASTA48754,176

References

« Hide 'large scale' references
[1]"Characterization of new members of the human type II keratin gene family and a general evaluation of the keratin gene domain on chromosome 12q13.13."
Rogers M.A., Edler L., Winter H., Langbein L., Beckmann I., Schweizer J.
J. Invest. Dermatol. 124:536-544(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
Tissue: Scalp.
[2]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Endometrial adenocarcinoma.
[3]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Prostate.
[5]"Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[6]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-45 AND SER-396, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[7]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AJ717743 mRNA. Translation: CAG30732.1.
BX537567 mRNA. Translation: CAD97784.1.
CH471111 Genomic DNA. Translation: EAW58237.1.
BC065180 mRNA. Translation: AAH65180.1.
RefSeqNP_001074961.1. NM_001081492.1.
NP_872313.2. NM_182507.2.
UniGeneHs.140978.

3D structure databases

ProteinModelPortalQ6KB66.
SMRQ6KB66. Positions 82-230, 247-389.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid126858. 3 interactions.
IntActQ6KB66. 1 interaction.
STRING9606.ENSP00000378292.

PTM databases

PhosphoSiteQ6KB66.

Polymorphism databases

DMDM166218808.

Proteomic databases

PaxDbQ6KB66.
PRIDEQ6KB66.

Protocols and materials databases

DNASU144501.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000313234; ENSP00000369361; ENSG00000167767. [Q6KB66-2]
ENST00000394815; ENSP00000378292; ENSG00000167767. [Q6KB66-1]
GeneID144501.
KEGGhsa:144501.
UCSCuc001rzw.3. human. [Q6KB66-3]
uc001rzx.3. human. [Q6KB66-1]
uc001rzy.3. human. [Q6KB66-2]

Organism-specific databases

CTD144501.
GeneCardsGC12M052562.
HGNCHGNC:27056. KRT80.
HPAHPA040782.
MIM611161. gene.
neXtProtNX_Q6KB66.
PharmGKBPA147357831.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG147372.
HOGENOMHOG000230976.
HOVERGENHBG013015.
KOK07605.
OMASCEVTPV.
OrthoDBEOG7FV3Q8.
PhylomeDBQ6KB66.
TreeFamTF317854.

Gene expression databases

BgeeQ6KB66.
CleanExHS_KRT80.
GenevestigatorQ6KB66.

Family and domain databases

InterProIPR001664. IF.
IPR003054. Keratin_II.
[Graphical view]
PANTHERPTHR23239. PTHR23239. 1 hit.
PfamPF00038. Filament. 1 hit.
[Graphical view]
PRINTSPR01276. TYPE2KERATIN.
ProtoNetSearch...

Other

GeneWikiKRT80.
GenomeRNAi144501.
NextBio84945.
PROQ6KB66.
SOURCESearch...

Entry information

Entry nameK2C80_HUMAN
AccessionPrimary (citable) accession number: Q6KB66
Secondary accession number(s): Q6P1A5, Q7Z3Q0
Entry history
Integrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: January 15, 2008
Last modified: April 16, 2014
This is version 82 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 12

Human chromosome 12: entries, gene names and cross-references to MIM