Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Keratin, type II cytoskeletal 80

Gene

KRT80

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei334Stutter1

GO - Molecular functioni

Complete GO annotation...

Enzyme and pathway databases

ReactomeiR-HSA-6805567. Keratinization.
R-HSA-6809371. Formation of the cornified envelope.

Names & Taxonomyi

Protein namesi
Recommended name:
Keratin, type II cytoskeletal 80
Alternative name(s):
Cytokeratin-80
Short name:
CK-80
Keratin-80
Short name:
K80
Type-II keratin Kb20
Gene namesi
Name:KRT80
Synonyms:KB20
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:27056. KRT80.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • intermediate filament Source: UniProtKB
  • keratin filament Source: InterPro
Complete GO annotation...

Keywords - Cellular componenti

Intermediate filament, Keratin

Pathology & Biotechi

Organism-specific databases

DisGeNETi144501.
OpenTargetsiENSG00000167767.
PharmGKBiPA147357831.

Polymorphism and mutation databases

BioMutaiKRT80.
DMDMi166218808.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003148961 – 452Keratin, type II cytoskeletal 80Add BLAST452

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei45PhosphoserineCombined sources1
Modified residuei396PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ6KB66.
PaxDbiQ6KB66.
PeptideAtlasiQ6KB66.
PRIDEiQ6KB66.

PTM databases

iPTMnetiQ6KB66.
PhosphoSitePlusiQ6KB66.

Expressioni

Tissue specificityi

Weakly expressed in tongue, but not skin or in any other tissues or organs examined.1 Publication

Gene expression databases

BgeeiENSG00000167767.
CleanExiHS_KRT80.
GenevisibleiQ6KB66. HS.

Organism-specific databases

HPAiHPA040782.

Interactioni

Subunit structurei

Heterotetramer of two type I and two type II keratins.

Binary interactionsi

WithEntry#Exp.IntActNotes
KRT15P190123EBI-3046635,EBI-739566
KRT20P359003EBI-3046635,EBI-742094
MEOX2A4D1273EBI-3046635,EBI-10172134

Protein-protein interaction databases

BioGridi126858. 8 interactors.
IntActiQ6KB66. 13 interactors.
STRINGi9606.ENSP00000378292.

Structurei

3D structure databases

ProteinModelPortaliQ6KB66.
SMRiQ6KB66.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 82HeadAdd BLAST82
Regioni82 – 118Coil 1AAdd BLAST37
Regioni83 – 390RodAdd BLAST308
Regioni119 – 135Linker 1Add BLAST17
Regioni136 – 227Coil 1BAdd BLAST92
Regioni228 – 251Linker 12Add BLAST24
Regioni252 – 390Coil 2Add BLAST139
Regioni391 – 452TailAdd BLAST62

Sequence similaritiesi

Belongs to the intermediate filament family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IGH5. Eukaryota.
ENOG411183I. LUCA.
GeneTreeiENSGT00830000128228.
HOGENOMiHOG000230976.
HOVERGENiHBG013015.
InParanoidiQ6KB66.
KOiK07605.
OMAiSCEVTPV.
OrthoDBiEOG091G0AOP.
PhylomeDBiQ6KB66.
TreeFamiTF317854.

Family and domain databases

InterProiIPR001664. IF.
IPR003054. Keratin_II.
[Graphical view]
PANTHERiPTHR23239. PTHR23239. 1 hit.
PfamiPF00038. Filament. 1 hit.
[Graphical view]
PRINTSiPR01276. TYPE2KERATIN.
SMARTiSM01391. Filament. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6KB66-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MACRSCVVGF SSLSSCEVTP VGSPRPGTSG WDSCRAPGPG FSSRSLTGCW
60 70 80 90 100
SAGTISKVTV NPGLLVPLDV KLDPAVQQLK NQEKEEMKAL NDKFASLIGK
110 120 130 140 150
VQALEQRNQL LETRWSFLQG QDSAIFDLGH LYEEYQGRLQ EELRKVSQER
160 170 180 190 200
GQLEANLLQV LEKVEEFRIR YEDEISKRTD MEFTFVQLKK DLDAECLHRT
210 220 230 240 250
ELETKLKSLE SFVELMKTIY EQELKDLAAQ VKDVSVTVGM DSRCHIDLSG
260 270 280 290 300
IVEEVKAQYD AVAARSLEEA EAYSRSQLEE QAARSAEYGS SLQSSRSEIA
310 320 330 340 350
DLNVRIQKLR SQILSVKSHC LKLEENIKTA EEQGELAFQD AKTKLAQLEA
360 370 380 390 400
ALQQAKQDMA RQLRKYQELM NVKLALDIEI ATYRKLVEGE EGRMDSPSAT
410 420 430 440 450
VVSAVQSRCK TAASRSGLSK APSRKKKGSK GPVIKITEMS EKYFSQESEV

SE
Length:452
Mass (Da):50,525
Last modified:January 15, 2008 - v2
Checksum:iBC54C53D0566FEA3
GO
Isoform 2 (identifier: Q6KB66-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     413-452: ASRSGLSKAPSRKKKGSKGPVIKITEMSEKYFSQESEVSE → PSLPYPLCSL

Show »
Length:422
Mass (Da):47,242
Checksum:i0ACF1622662D27E2
GO
Isoform 3 (identifier: Q6KB66-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-100: MACRSCVVGF...NDKFASLIGK → MSCHFPGSPP...DPFAAFLLSQ
     190-190: K → KVACPACPRG...PTTHHCCQPQ

Note: No experimental confirmation available.
Show »
Length:487
Mass (Da):54,176
Checksum:iDF0C64CD3A800AF6
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti230Q → L in CAG30732 (PubMed:15737194).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_049807238V → I.Corresponds to variant rs35725856dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0304211 – 100MACRS…SLIGK → MSCHFPGSPPWALAGQPGAS APDWSTPDPFAAFLLSQ in isoform 3. 1 PublicationAdd BLAST100
Alternative sequenceiVSP_030422190K → KVACPACPRGSFLMGPGPSF PPDILLSFMPNQSPQRLKSQ DQQTDRGIPPSPSSSFFEAL SQISSGITPTLTQEAAPQPT PALGPSIPSPTTHHCCQPQ in isoform 3. 1 Publication1
Alternative sequenceiVSP_030423413 – 452ASRSG…SEVSE → PSLPYPLCSL in isoform 2. 1 PublicationAdd BLAST40

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ717743 mRNA. Translation: CAG30732.1.
BX537567 mRNA. Translation: CAD97784.1.
CH471111 Genomic DNA. Translation: EAW58237.1.
BC065180 mRNA. Translation: AAH65180.1.
CCDSiCCDS41784.1. [Q6KB66-2]
CCDS8821.2. [Q6KB66-1]
RefSeqiNP_001074961.1. NM_001081492.1. [Q6KB66-2]
NP_872313.2. NM_182507.2. [Q6KB66-1]
UniGeneiHs.140978.

Genome annotation databases

EnsembliENST00000313234; ENSP00000369361; ENSG00000167767. [Q6KB66-2]
ENST00000394815; ENSP00000378292; ENSG00000167767. [Q6KB66-1]
GeneIDi144501.
KEGGihsa:144501.
UCSCiuc001rzx.3. human. [Q6KB66-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ717743 mRNA. Translation: CAG30732.1.
BX537567 mRNA. Translation: CAD97784.1.
CH471111 Genomic DNA. Translation: EAW58237.1.
BC065180 mRNA. Translation: AAH65180.1.
CCDSiCCDS41784.1. [Q6KB66-2]
CCDS8821.2. [Q6KB66-1]
RefSeqiNP_001074961.1. NM_001081492.1. [Q6KB66-2]
NP_872313.2. NM_182507.2. [Q6KB66-1]
UniGeneiHs.140978.

3D structure databases

ProteinModelPortaliQ6KB66.
SMRiQ6KB66.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126858. 8 interactors.
IntActiQ6KB66. 13 interactors.
STRINGi9606.ENSP00000378292.

PTM databases

iPTMnetiQ6KB66.
PhosphoSitePlusiQ6KB66.

Polymorphism and mutation databases

BioMutaiKRT80.
DMDMi166218808.

Proteomic databases

EPDiQ6KB66.
PaxDbiQ6KB66.
PeptideAtlasiQ6KB66.
PRIDEiQ6KB66.

Protocols and materials databases

DNASUi144501.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000313234; ENSP00000369361; ENSG00000167767. [Q6KB66-2]
ENST00000394815; ENSP00000378292; ENSG00000167767. [Q6KB66-1]
GeneIDi144501.
KEGGihsa:144501.
UCSCiuc001rzx.3. human. [Q6KB66-1]

Organism-specific databases

CTDi144501.
DisGeNETi144501.
GeneCardsiKRT80.
HGNCiHGNC:27056. KRT80.
HPAiHPA040782.
MIMi611161. gene.
neXtProtiNX_Q6KB66.
OpenTargetsiENSG00000167767.
PharmGKBiPA147357831.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IGH5. Eukaryota.
ENOG411183I. LUCA.
GeneTreeiENSGT00830000128228.
HOGENOMiHOG000230976.
HOVERGENiHBG013015.
InParanoidiQ6KB66.
KOiK07605.
OMAiSCEVTPV.
OrthoDBiEOG091G0AOP.
PhylomeDBiQ6KB66.
TreeFamiTF317854.

Enzyme and pathway databases

ReactomeiR-HSA-6805567. Keratinization.
R-HSA-6809371. Formation of the cornified envelope.

Miscellaneous databases

GeneWikiiKRT80.
GenomeRNAii144501.
PROiQ6KB66.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000167767.
CleanExiHS_KRT80.
GenevisibleiQ6KB66. HS.

Family and domain databases

InterProiIPR001664. IF.
IPR003054. Keratin_II.
[Graphical view]
PANTHERiPTHR23239. PTHR23239. 1 hit.
PfamiPF00038. Filament. 1 hit.
[Graphical view]
PRINTSiPR01276. TYPE2KERATIN.
SMARTiSM01391. Filament. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiK2C80_HUMAN
AccessioniPrimary (citable) accession number: Q6KB66
Secondary accession number(s): Q6P1A5, Q7Z3Q0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: January 15, 2008
Last modified: November 30, 2016
This is version 107 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

There are two types of cytoskeletal and microfibrillar keratin, I (acidic) and II (neutral to basic) (40-55 and 56-70 kDa, respectively).

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.