Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Pyrin and HIN domain-containing protein 1

Gene

PYHIN1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Major mediator of the tumor suppressor activity of IFN in breast cancer cells. Promotes ubiquitination and subsequent degradation of MDM2, which leads to p53/TP53 stabilization. Promotes ubiquitination and subsequent degradation of HDAC1, which in turn enhances maspin expression, and impairs invasive activity of cancer cells.2 Publications

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Cell cycle

Names & Taxonomyi

Protein namesi
Recommended name:
Pyrin and HIN domain-containing protein 1
Alternative name(s):
Interferon-inducible protein X
Gene namesi
Name:PYHIN1
Synonyms:IFIX
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:28894. PYHIN1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Keywords - Diseasei

Tumor suppressor

Organism-specific databases

PharmGKBiPA134967485.

Polymorphism and mutation databases

BioMutaiPYHIN1.
DMDMi74748871.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 492492Pyrin and HIN domain-containing protein 1PRO_0000334524Add
BLAST

Proteomic databases

EPDiQ6K0P9.
MaxQBiQ6K0P9.
PaxDbiQ6K0P9.
PeptideAtlasiQ6K0P9.
PRIDEiQ6K0P9.

PTM databases

iPTMnetiQ6K0P9.
PhosphoSiteiQ6K0P9.
SwissPalmiQ6K0P9.

Expressioni

Tissue specificityi

Expressed in spleen, lymph node and peripheral blood leukocytes, and at lower levels in thymus, bone marrow and fetal liver. Down-regulated in breast tumors.1 Publication

Inductioni

By IFN-alphas and IFNG/IFN-gamma in hematopoietic cancer cells.1 Publication

Gene expression databases

BgeeiQ6K0P9.
CleanExiHS_PYHIN1.
ExpressionAtlasiQ6K0P9. baseline and differential.
GenevisibleiQ6K0P9. HS.

Organism-specific databases

HPAiHPA051224.

Interactioni

Subunit structurei

Interacts with MDM2.1 Publication

Protein-protein interaction databases

BioGridi127225. 18 interactions.
IntActiQ6K0P9. 107 interactions.
STRINGi9606.ENSP00000357122.

Structurei

3D structure databases

ProteinModelPortaliQ6K0P9.
SMRiQ6K0P9. Positions 8-86, 208-399.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 8888PyrinPROSITE-ProRule annotationAdd
BLAST
Domaini199 – 399201HIN-200PROSITE-ProRule annotationAdd
BLAST

Domaini

The HIN-200 domain mediates interaction with MDM2.

Sequence similaritiesi

Belongs to the HIN-200 family.Curated
Contains 1 HIN-200 domain.PROSITE-ProRule annotation
Contains 1 pyrin domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiENOG410J5NP. Eukaryota.
ENOG410Y78B. LUCA.
GeneTreeiENSGT00390000013296.
HOGENOMiHOG000033871.
HOVERGENiHBG006122.
InParanoidiQ6K0P9.
OMAiNILHKQT.
OrthoDBiEOG7ZD1V8.
PhylomeDBiQ6K0P9.
TreeFamiTF337385.

Family and domain databases

Gene3Di2.40.50.140. 2 hits.
InterProiIPR004020. DAPIN.
IPR004021. HIN200/IF120x.
IPR012340. NA-bd_OB-fold.
[Graphical view]
PfamiPF02760. HIN. 1 hit.
PF02758. PYRIN. 1 hit.
[Graphical view]
SMARTiSM01289. PYRIN. 1 hit.
[Graphical view]
PROSITEiPS50824. DAPIN. 1 hit.
PS50834. HIN_200. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6K0P9-1) [UniParc]FASTAAdd to basket

Also known as: alpha1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MANNYKKIVL LKGLEVINDY HFRIVKSLLS NDLKLNPKMK EEYDKIQIAD
60 70 80 90 100
LMEEKFPGDA GLGKLIEFFK EIPTLGDLAE TLKREKLKVA NKIESIPVKG
110 120 130 140 150
IIPSKKTKQK EVYPATPACT PSNRLTAKGA EETLGPQKRK KPSEEETGTK
160 170 180 190 200
RSKMSKEQTR PSCSAGASTS TAMGRSPPPQ TSSSAPPNTS STESLKPLAN
210 220 230 240 250
RHATASKNIF REDPIIAMVL NATKVFKYES SENEQRRMFH ATVATQTQFF
260 270 280 290 300
HVKVLNINLK RKFIKKRIII ISNYSKRNSL LEVNEASSVS EAGPDQTFEV
310 320 330 340 350
PKDIIRRAKK IPKINILHKQ TSGYIVYGLF MLHTKIVNRK TTIYEIQDKT
360 370 380 390 400
GSMAVVGKGE CHNIPCEKGD KLRLFCFRLR KRENMSKLMS EMHSFIQIQK
410 420 430 440 450
NTNQRSHDSR SMALPQEQSQ HPKPSEASTT LPESHLKTPQ MPPTTPSSSS
460 470 480 490
FTKKDETHPG AQSSPANFRI TSPTVAPPLS SDTSTNRHPA VP
Length:492
Mass (Da):55,065
Last modified:July 5, 2004 - v1
Checksum:i8711AABB92477D10
GO
Isoform 2 (identifier: Q6K0P9-2) [UniParc]FASTAAdd to basket

Also known as: alpha2

The sequence of this isoform differs from the canonical sequence as follows:
     89-97: Missing.

Show »
Length:483
Mass (Da):54,113
Checksum:i031BBFA420FA6C9E
GO
Isoform 3 (identifier: Q6K0P9-3) [UniParc]FASTAAdd to basket

Also known as: beta1

The sequence of this isoform differs from the canonical sequence as follows:
     454-492: KDETHPGAQSSPANFRITSPTVAPPLSSDTSTNRHPAVP → VTKDKDIK

Show »
Length:461
Mass (Da):51,942
Checksum:iF22EB4E2112D7CB7
GO
Isoform 4 (identifier: Q6K0P9-4) [UniParc]FASTAAdd to basket

Also known as: beta2

The sequence of this isoform differs from the canonical sequence as follows:
     89-97: Missing.
     454-492: KDETHPGAQSSPANFRITSPTVAPPLSSDTSTNRHPAVP → VTKDKDIK

Show »
Length:452
Mass (Da):50,990
Checksum:iD0EC5EBE88910453
GO
Isoform 5 (identifier: Q6K0P9-5) [UniParc]FASTAAdd to basket

Also known as: gamma1

The sequence of this isoform differs from the canonical sequence as follows:
     194-245: SLKPLANRHA...RRMFHATVAT → AYLMNLTLSL...IYYTPIPFAH
     246-492: Missing.

Show »
Length:245
Mass (Da):26,951
Checksum:iDF21BA91B252774A
GO
Isoform 6 (identifier: Q6K0P9-6) [UniParc]FASTAAdd to basket

Also known as: gamma2

The sequence of this isoform differs from the canonical sequence as follows:
     89-97: Missing.
     194-245: SLKPLANRHA...RRMFHATVAT → AYLMNLTLSL...IYYTPIPFAH
     246-492: Missing.

Show »
Length:236
Mass (Da):25,999
Checksum:iE1EBF154B6D113A7
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei89 – 979Missing in isoform 2, isoform 4 and isoform 6. 2 PublicationsVSP_033657
Alternative sequencei194 – 24552SLKPL…ATVAT → AYLMNLTLSLTAGSFLSCAV WGRDRELRNLELSATDSLST APIYYTPIPFAH in isoform 5 and isoform 6. 2 PublicationsVSP_033658Add
BLAST
Alternative sequencei246 – 492247Missing in isoform 5 and isoform 6. 2 PublicationsVSP_033659Add
BLAST
Alternative sequencei454 – 49239KDETH…HPAVP → VTKDKDIK in isoform 3 and isoform 4. 2 PublicationsVSP_033660Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY185344 mRNA. Translation: AAO67506.1.
AY185345 mRNA. Translation: AAO67507.1.
AY185346 mRNA. Translation: AAO67508.1.
AY185347 mRNA. Translation: AAO67509.1.
AL359753 Genomic DNA. Translation: CAI15075.1.
AL359753 Genomic DNA. Translation: CAI15076.1.
AL359753 Genomic DNA. Translation: CAI15077.1.
AL359753 Genomic DNA. Translation: CAI15078.1.
AL359753 Genomic DNA. Translation: CAI15079.1.
AL359753 Genomic DNA. Translation: CAI15080.1.
CH471121 Genomic DNA. Translation: EAW52805.1.
BC020822 mRNA. Translation: AAH20822.1.
BC090944 mRNA. Translation: AAH90944.1.
BC139741 mRNA. Translation: AAI39742.1.
CCDSiCCDS1178.1. [Q6K0P9-1]
CCDS1179.1. [Q6K0P9-2]
CCDS30907.1. [Q6K0P9-3]
CCDS30908.1. [Q6K0P9-4]
RefSeqiNP_689714.2. NM_152501.4. [Q6K0P9-1]
NP_945146.1. NM_198928.4. [Q6K0P9-2]
NP_945147.1. NM_198929.4. [Q6K0P9-3]
NP_945148.1. NM_198930.3. [Q6K0P9-4]
XP_005244987.1. XM_005244930.1. [Q6K0P9-5]
XP_011507544.1. XM_011509242.1. [Q6K0P9-1]
UniGeneiHs.710248.
Hs.745322.

Genome annotation databases

EnsembliENST00000368135; ENSP00000357117; ENSG00000163564. [Q6K0P9-5]
ENST00000368138; ENSP00000357120; ENSG00000163564. [Q6K0P9-2]
ENST00000368140; ENSP00000357122; ENSG00000163564. [Q6K0P9-1]
ENST00000392252; ENSP00000376082; ENSG00000163564. [Q6K0P9-4]
ENST00000392254; ENSP00000376083; ENSG00000163564. [Q6K0P9-3]
GeneIDi149628.
KEGGihsa:149628.
UCSCiuc001fta.5. human. [Q6K0P9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY185344 mRNA. Translation: AAO67506.1.
AY185345 mRNA. Translation: AAO67507.1.
AY185346 mRNA. Translation: AAO67508.1.
AY185347 mRNA. Translation: AAO67509.1.
AL359753 Genomic DNA. Translation: CAI15075.1.
AL359753 Genomic DNA. Translation: CAI15076.1.
AL359753 Genomic DNA. Translation: CAI15077.1.
AL359753 Genomic DNA. Translation: CAI15078.1.
AL359753 Genomic DNA. Translation: CAI15079.1.
AL359753 Genomic DNA. Translation: CAI15080.1.
CH471121 Genomic DNA. Translation: EAW52805.1.
BC020822 mRNA. Translation: AAH20822.1.
BC090944 mRNA. Translation: AAH90944.1.
BC139741 mRNA. Translation: AAI39742.1.
CCDSiCCDS1178.1. [Q6K0P9-1]
CCDS1179.1. [Q6K0P9-2]
CCDS30907.1. [Q6K0P9-3]
CCDS30908.1. [Q6K0P9-4]
RefSeqiNP_689714.2. NM_152501.4. [Q6K0P9-1]
NP_945146.1. NM_198928.4. [Q6K0P9-2]
NP_945147.1. NM_198929.4. [Q6K0P9-3]
NP_945148.1. NM_198930.3. [Q6K0P9-4]
XP_005244987.1. XM_005244930.1. [Q6K0P9-5]
XP_011507544.1. XM_011509242.1. [Q6K0P9-1]
UniGeneiHs.710248.
Hs.745322.

3D structure databases

ProteinModelPortaliQ6K0P9.
SMRiQ6K0P9. Positions 8-86, 208-399.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127225. 18 interactions.
IntActiQ6K0P9. 107 interactions.
STRINGi9606.ENSP00000357122.

PTM databases

iPTMnetiQ6K0P9.
PhosphoSiteiQ6K0P9.
SwissPalmiQ6K0P9.

Polymorphism and mutation databases

BioMutaiPYHIN1.
DMDMi74748871.

Proteomic databases

EPDiQ6K0P9.
MaxQBiQ6K0P9.
PaxDbiQ6K0P9.
PeptideAtlasiQ6K0P9.
PRIDEiQ6K0P9.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000368135; ENSP00000357117; ENSG00000163564. [Q6K0P9-5]
ENST00000368138; ENSP00000357120; ENSG00000163564. [Q6K0P9-2]
ENST00000368140; ENSP00000357122; ENSG00000163564. [Q6K0P9-1]
ENST00000392252; ENSP00000376082; ENSG00000163564. [Q6K0P9-4]
ENST00000392254; ENSP00000376083; ENSG00000163564. [Q6K0P9-3]
GeneIDi149628.
KEGGihsa:149628.
UCSCiuc001fta.5. human. [Q6K0P9-1]

Organism-specific databases

CTDi149628.
GeneCardsiPYHIN1.
HGNCiHGNC:28894. PYHIN1.
HPAiHPA051224.
MIMi612677. gene.
neXtProtiNX_Q6K0P9.
PharmGKBiPA134967485.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J5NP. Eukaryota.
ENOG410Y78B. LUCA.
GeneTreeiENSGT00390000013296.
HOGENOMiHOG000033871.
HOVERGENiHBG006122.
InParanoidiQ6K0P9.
OMAiNILHKQT.
OrthoDBiEOG7ZD1V8.
PhylomeDBiQ6K0P9.
TreeFamiTF337385.

Miscellaneous databases

GenomeRNAii149628.
PROiQ6K0P9.
SOURCEiSearch...

Gene expression databases

BgeeiQ6K0P9.
CleanExiHS_PYHIN1.
ExpressionAtlasiQ6K0P9. baseline and differential.
GenevisibleiQ6K0P9. HS.

Family and domain databases

Gene3Di2.40.50.140. 2 hits.
InterProiIPR004020. DAPIN.
IPR004021. HIN200/IF120x.
IPR012340. NA-bd_OB-fold.
[Graphical view]
PfamiPF02760. HIN. 1 hit.
PF02758. PYRIN. 1 hit.
[Graphical view]
SMARTiSM01289. PYRIN. 1 hit.
[Graphical view]
PROSITEiPS50824. DAPIN. 1 hit.
PS50834. HIN_200. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Antitumor activity of IFIX, a novel interferon-inducible HIN-200 gene, in breast cancer."
    Ding Y., Wang L., Su L.-K., Frey J.A., Shao R., Hunt K.K., Yan D.-H.
    Oncogene 23:4556-4566(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4 AND 5), SUBCELLULAR LOCATION, INDUCTION BY IFN, TISSUE SPECIFICITY.
  2. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 6).
    Tissue: Lung.
  5. "Interferon-inducible protein IFIXalpha1 functions as a negative regulator of HDM2."
    Ding Y., Lee J.-F., Lu H., Lee M.-H., Yan D.-H.
    Mol. Cell. Biol. 26:1979-1996(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH MDM2.
  6. "Interferon-inducible protein IFIXalpha inhibits cell invasion by upregulating the metastasis suppressor maspin."
    Yamaguchi H., Ding Y., Lee J.-F., Zhang M., Pal A., Bornmann W., Yan D.-H., Hung M.-C.
    Mol. Carcinog. 47:739-743(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.

Entry informationi

Entry nameiIFIX_HUMAN
AccessioniPrimary (citable) accession number: Q6K0P9
Secondary accession number(s): Q5T3W6
, Q6K0P6, Q6K0P7, Q6K0P8, Q8WW65
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: July 5, 2004
Last modified: July 6, 2016
This is version 100 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.