Q6K0P9 (IFIX_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 64.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Pyrin and HIN domain-containing protein 1 Alternative name(s): Interferon-inducible protein X | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 492 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Major mediator of the tumor suppressor activity of IFN in breast cancer cells. Promotes ubiquitination and subsequent degradation of MDM2, which leads to p53/TP53 stabilization. Promotes ubiquitination and subsequent degradation of HDAC1, which in turn enhances maspin expression, and impairs invasive activity of cancer cells. Ref.5 Ref.6 |
| Subunit structure | Interacts with MDM2. Ref.5 |
| Subcellular location | Isoform 1: Nucleus › nucleoplasm Ref.1. Isoform 3: Nucleus › nucleoplasm Ref.1. Isoform 5: Nucleus. Nucleus speckle Ref.1. |
| Tissue specificity | Expressed in spleen, lymph node and peripheral blood leukocytes, and at lower levels in thymus, bone marrow and fetal liver. Down-regulated in breast tumors. Ref.1 |
| Induction | By IFN-alphas and IFNG/IFN-gamma in hematopoietic cancer cells. Ref.1 |
| Domain | The HIN-200 domain mediates interaction with MDM2. |
| Sequence similarities | Belongs to the HIN-200 family. Contains 1 DAPIN domain. Contains 1 HIN-200 domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell cycle |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Disease | Tumor suppressor |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | cell cycle Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | nuclear speck Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6K0P9-1) Also known as: alpha1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6K0P9-2) Also known as: alpha2; The sequence of this isoform differs from the canonical sequence as follows: 89-97: Missing. | ||||||
| Isoform 3 (identifier: Q6K0P9-3) Also known as: beta1; The sequence of this isoform differs from the canonical sequence as follows: 454-492: KDETHPGAQSSPANFRITSPTVAPPLSSDTSTNRHPAVP → VTKDKDIK | ||||||
| Isoform 4 (identifier: Q6K0P9-4) Also known as: beta2; The sequence of this isoform differs from the canonical sequence as follows: 89-97: Missing. 454-492: KDETHPGAQSSPANFRITSPTVAPPLSSDTSTNRHPAVP → VTKDKDIK | ||||||
| Isoform 5 (identifier: Q6K0P9-5) Also known as: gamma1; The sequence of this isoform differs from the canonical sequence as follows: 194-245: SLKPLANRHA...RRMFHATVAT → AYLMNLTLSL...IYYTPIPFAH 246-492: Missing. | ||||||
| Isoform 6 (identifier: Q6K0P9-6) Also known as: gamma2; The sequence of this isoform differs from the canonical sequence as follows: 89-97: Missing. 194-245: SLKPLANRHA...RRMFHATVAT → AYLMNLTLSL...IYYTPIPFAH 246-492: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 492 | 492 | Pyrin and HIN domain-containing protein 1 | PRO_0000334524 | |||||
Regions | |||||||||
| Domain | 1 – 88 | 88 | DAPIN | ||||||
| Domain | 199 – 399 | 201 | HIN-200 | ||||||
Natural variations | |||||||||
| Alternative sequence | 89 – 97 | 9 | Missing in isoform 2, isoform 4 and isoform 6. | VSP_033657 | |||||
| Alternative sequence | 194 – 245 | 52 | SLKPL…ATVAT → AYLMNLTLSLTAGSFLSCAV WGRDRELRNLELSATDSLST APIYYTPIPFAH in isoform 5 and isoform 6. | VSP_033658 | |||||
| Alternative sequence | 246 – 492 | 247 | Missing in isoform 5 and isoform 6. | VSP_033659 | |||||
| Alternative sequence | 454 – 492 | 39 | KDETH…HPAVP → VTKDKDIK in isoform 3 and isoform 4. | VSP_033660 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Antitumor activity of IFIX, a novel interferon-inducible HIN-200 gene, in breast cancer." Ding Y., Wang L., Su L.-K., Frey J.A., Shao R., Hunt K.K., Yan D.-H. Oncogene 23:4556-4566(2004) [PubMed: 15122330] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4 AND 5), SUBCELLULAR LOCATION, INDUCTION BY IFN, TISSUE SPECIFICITY. |
| [2] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed: 16710414] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 6). Tissue: Lung. |
| [5] | "Interferon-inducible protein IFIXalpha1 functions as a negative regulator of HDM2." Ding Y., Lee J.-F., Lu H., Lee M.-H., Yan D.-H. Mol. Cell. Biol. 26:1979-1996(2006) [PubMed: 16479015] [Abstract] Cited for: FUNCTION, INTERACTION WITH MDM2. |
| [6] | "Interferon-inducible protein IFIXalpha inhibits cell invasion by upregulating the metastasis suppressor maspin." Yamaguchi H., Ding Y., Lee J.-F., Zhang M., Pal A., Bornmann W., Yan D.-H., Hung M.-C. Mol. Carcinog. 47:739-743(2008) [PubMed: 18247378] [Abstract] Cited for: FUNCTION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY185344 mRNA. Translation: AAO67506.1. AY185345 mRNA. Translation: AAO67507.1. AY185346 mRNA. Translation: AAO67508.1. AY185347 mRNA. Translation: AAO67509.1. AL359753 Genomic DNA. Translation: CAI15075.1. AL359753 Genomic DNA. Translation: CAI15076.1. AL359753 Genomic DNA. Translation: CAI15077.1. AL359753 Genomic DNA. Translation: CAI15078.1. AL359753 Genomic DNA. Translation: CAI15079.1. AL359753 Genomic DNA. Translation: CAI15080.1. CH471121 Genomic DNA. Translation: EAW52805.1. BC020822 mRNA. Translation: AAH20822.1. BC090944 mRNA. Translation: AAH90944.1. BC139741 mRNA. Translation: AAI39742.1. |
| IPI | IPI00103253. IPI00397542. IPI00397544. IPI00398847. IPI00412281. IPI00893471. |
| RefSeq | NP_689714.2. NM_152501.4. NP_945146.1. NM_198928.4. NP_945147.1. NM_198929.4. NP_945148.1. NM_198930.3. |
| UniGene | Hs.710248. |
3D structure databases | |
| HSSP | HSSP built from PDB template 2DBG based on UniProtKB P41218. |
| ProteinModelPortal | Q6K0P9. |
| SMR | Q6K0P9. Positions 1-90, 208-399. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q6K0P9. |
PTM databases | |
| PhosphoSite | Q6K0P9. |
Polymorphism databases | |
| DMDM | 74748871. |
Proteomic databases | |
| PRIDE | Q6K0P9. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000368140; ENSP00000357122; ENSG00000163564. |
| GeneID | 149628. |
| KEGG | hsa:149628. |
| UCSC | uc001fta.2. human. uc001ftb.1. human. uc001ftc.1. human. uc001ftd.1. human. uc001fte.1. human. |
Organism-specific databases | |
| CTD | 149628. |
| GeneCards | GC01P158900. |
| H-InvDB | HIX0001193. |
| HGNC | HGNC:28894. PYHIN1. |
| MIM | 612677. gene. |
| neXtProt | NX_Q6K0P9. |
| PharmGKB | PA134967485. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG09439. |
| GeneTree | ENSGT00390000013296. |
| HOGENOM | HBG283725. |
| HOVERGEN | HBG006122. |
| InParanoid | Q6K0P9. |
| OMA | QRSHDSR. |
| PhylomeDB | Q6K0P9. |
Gene expression databases | |
| ArrayExpress | Q6K0P9. |
| Bgee | Q6K0P9. |
| CleanEx | HS_PYHIN1. |
| Genevestigator | Q6K0P9. |
Family and domain databases | |
| InterPro | IPR004021. HIN200/IF120x. IPR012340. NA-bd_OB-fold. IPR004020. Pyrin. [Graphical view] |
| Gene3D | G3DSA:2.40.50.140. OB_NA_bd_sub. 2 hits. |
| Pfam | PF02760. HIN. 1 hit. PF02758. PAAD_DAPIN. 1 hit. [Graphical view] |
| PROSITE | PS50824. DAPIN. 1 hit. PS50834. HIN_200. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 86205. |
| SOURCE | Search... |
Entry information
| Entry name | IFIX_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6K0P9 Secondary accession number(s): Q5T3W6 Q8WW65 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with