Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Epididymal-specific lipocalin-10

Gene

LCN10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

May play a role in male fertility. May act as a retinoid carrier protein within the epididymis.

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transport

Names & Taxonomyi

Protein namesi
Recommended name:
Epididymal-specific lipocalin-10
Gene namesi
Name:LCN10
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

HGNCiHGNC:20892. LCN10.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134942375.

Polymorphism and mutation databases

BioMutaiLCN10.
DMDMi62286922.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1919Sequence analysisAdd
BLAST
Chaini20 – 187168Epididymal-specific lipocalin-10PRO_0000017920Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi90 ↔ 163By similarity
Glycosylationi149 – 1491N-linked (GlcNAc...)Sequence analysis
Modified residuei170 – 1701N6-acetyllysineCombined sources

Keywords - PTMi

Acetylation, Disulfide bond, Glycoprotein

Proteomic databases

PRIDEiQ6JVE6.

Expressioni

Gene expression databases

BgeeiENSG00000187922.
CleanExiHS_LCN10.
ExpressionAtlasiQ6JVE6. baseline and differential.

Organism-specific databases

HPAiHPA055919.

Structurei

3D structure databases

ProteinModelPortaliQ6JVE6.
SMRiQ6JVE6. Positions 35-177.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the calycin superfamily. Lipocalin family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

GeneTreeiENSGT00440000034348.
HOGENOMiHOG000236359.
HOVERGENiHBG052315.
InParanoidiQ6JVE6.
OMAiRSQGCQS.
OrthoDBiEOG091G0QSZ.
PhylomeDBiQ6JVE6.
TreeFamiTF336103.

Family and domain databases

Gene3Di2.40.128.20. 1 hit.
InterProiIPR012674. Calycin.
IPR011038. Calycin-like.
IPR022272. Lipocalin_CS.
[Graphical view]
SUPFAMiSSF50814. SSF50814. 1 hit.
PROSITEiPS00213. LIPOCALIN. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6JVE6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRQGLLVLAL VLVLVLVLAA GSQVQEWYPR ESHALNWNKF SGFWYILATA
60 70 80 90 100
TDAQGFLPAR DKRKLGASVV KVNKVGQLRV LLAFRRGQGC GRAQPRHPGT
110 120 130 140 150
SGHLWASLSV KGVKAFHVLS TDYSYGLVYL RLGRATQNYK NLLLFHRQNV
160 170 180
SSFQSLKEFM DACDILGLSK AAVILPKDAS RTHTILP
Length:187
Mass (Da):20,759
Last modified:July 5, 2004 - v1
Checksum:i32D1ED028AE333A7
GO
Isoform 2 (identifier: Q6JVE6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     87-109: GQGCGRAQPRHPGTSGHLWASLS → LKGCQSQEVILRKDGKKPVFGNACAYAAGPREGQEG

Show »
Length:200
Mass (Da):22,205
Checksum:iC1D918E599F4A3F8
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei87 – 10923GQGCG…WASLS → LKGCQSQEVILRKDGKKPVF GNACAYAAGPREGQEG in isoform 2. 1 PublicationVSP_040220Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY301271 mRNA. Translation: AAQ81976.1.
AL355987 Genomic DNA. Translation: CAQ09951.1.
AL355987 Genomic DNA. Translation: CAQ09952.1.
BC133045 mRNA. Translation: AAI33046.1.
CCDSiCCDS35182.2. [Q6JVE6-2]
RefSeqiNP_001001712.2. NM_001001712.2. [Q6JVE6-2]
UniGeneiHs.98132.

Genome annotation databases

EnsembliENST00000474369; ENSP00000420564; ENSG00000187922. [Q6JVE6-1]
ENST00000497771; ENSP00000418491; ENSG00000187922. [Q6JVE6-2]
GeneIDi414332.
KEGGihsa:414332.
UCSCiuc004civ.4. human. [Q6JVE6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY301271 mRNA. Translation: AAQ81976.1.
AL355987 Genomic DNA. Translation: CAQ09951.1.
AL355987 Genomic DNA. Translation: CAQ09952.1.
BC133045 mRNA. Translation: AAI33046.1.
CCDSiCCDS35182.2. [Q6JVE6-2]
RefSeqiNP_001001712.2. NM_001001712.2. [Q6JVE6-2]
UniGeneiHs.98132.

3D structure databases

ProteinModelPortaliQ6JVE6.
SMRiQ6JVE6. Positions 35-177.
ModBaseiSearch...
MobiDBiSearch...

Polymorphism and mutation databases

BioMutaiLCN10.
DMDMi62286922.

Proteomic databases

PRIDEiQ6JVE6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000474369; ENSP00000420564; ENSG00000187922. [Q6JVE6-1]
ENST00000497771; ENSP00000418491; ENSG00000187922. [Q6JVE6-2]
GeneIDi414332.
KEGGihsa:414332.
UCSCiuc004civ.4. human. [Q6JVE6-1]

Organism-specific databases

CTDi414332.
GeneCardsiLCN10.
H-InvDBHIX0079162.
HGNCiHGNC:20892. LCN10.
HPAiHPA055919.
MIMi612904. gene.
neXtProtiNX_Q6JVE6.
PharmGKBiPA134942375.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00440000034348.
HOGENOMiHOG000236359.
HOVERGENiHBG052315.
InParanoidiQ6JVE6.
OMAiRSQGCQS.
OrthoDBiEOG091G0QSZ.
PhylomeDBiQ6JVE6.
TreeFamiTF336103.

Miscellaneous databases

GenomeRNAii414332.
PROiQ6JVE6.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000187922.
CleanExiHS_LCN10.
ExpressionAtlasiQ6JVE6. baseline and differential.

Family and domain databases

Gene3Di2.40.128.20. 1 hit.
InterProiIPR012674. Calycin.
IPR011038. Calycin-like.
IPR022272. Lipocalin_CS.
[Graphical view]
SUPFAMiSSF50814. SSF50814. 1 hit.
PROSITEiPS00213. LIPOCALIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiLCN10_HUMAN
AccessioniPrimary (citable) accession number: Q6JVE6
Secondary accession number(s): A2RUU3, B0QZ79
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 29, 2005
Last sequence update: July 5, 2004
Last modified: September 7, 2016
This is version 103 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.