Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Acyl-CoA dehydrogenase family member 10

Gene

ACAD10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acyl-CoA dehydrogenase only active with R- and S-2-methyl-C15-CoA.1 Publication

Catalytic activityi

Acyl-CoA + acceptor = 2,3-dehydroacyl-CoA + reduced acceptor.

Cofactori

FADBy similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei828FADBy similarity1
Binding sitei943FADBy similarity1
Binding sitei1013FADBy similarity1
Binding sitei1044FADBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi792 – 802FADBy similarityAdd BLAST11

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Oxidoreductase

Keywords - Ligandi

FAD, Flavoprotein

Enzyme and pathway databases

ReactomeiR-HSA-77289. Mitochondrial Fatty Acid Beta-Oxidation.

Names & Taxonomyi

Protein namesi
Recommended name:
Acyl-CoA dehydrogenase family member 10 (EC:1.3.99.-)
Short name:
ACAD-10
Gene namesi
Name:ACAD10
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:21597. ACAD10.

Subcellular locationi

GO - Cellular componenti

  • mitochondrial matrix Source: Reactome
  • mitochondrion Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

DisGeNETi80724.
OpenTargetsiENSG00000111271.
PharmGKBiPA134976754.

Polymorphism and mutation databases

BioMutaiACAD10.
DMDMi74748862.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002847701 – 1059Acyl-CoA dehydrogenase family member 10Add BLAST1059

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei413N6-succinyllysineBy similarity1
Modified residuei427N6-acetyllysine; alternateBy similarity1
Modified residuei427N6-succinyllysine; alternateBy similarity1
Modified residuei1052N6-acetyllysine; alternateBy similarity1
Modified residuei1052N6-succinyllysine; alternateBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ6JQN1.
MaxQBiQ6JQN1.
PaxDbiQ6JQN1.
PeptideAtlasiQ6JQN1.
PRIDEiQ6JQN1.

PTM databases

iPTMnetiQ6JQN1.
PhosphoSitePlusiQ6JQN1.

Expressioni

Tissue specificityi

Widely expressed with highest expression in fetal brain, followed by heart, muscle, kidney and adult brain. Expression levels varying from isoform to isoform.2 Publications

Gene expression databases

BgeeiENSG00000111271.
CleanExiHS_ACAD10.
ExpressionAtlasiQ6JQN1. baseline and differential.
GenevisibleiQ6JQN1. HS.

Organism-specific databases

HPAiHPA067222.

Interactioni

Protein-protein interaction databases

BioGridi123274. 23 interactors.
IntActiQ6JQN1. 2 interactors.
STRINGi9606.ENSP00000389813.

Structurei

3D structure databases

ProteinModelPortaliQ6JQN1.
SMRiQ6JQN1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the acyl-CoA dehydrogenase family.Curated

Phylogenomic databases

eggNOGiKOG1469. Eukaryota.
KOG3085. Eukaryota.
COG3173. LUCA.
GeneTreeiENSGT00760000119007.
HOGENOMiHOG000131666.
HOVERGENiHBG057142.
InParanoidiQ6JQN1.
KOiK11729.
OMAiAIGLQKY.
OrthoDBiEOG091G03B8.
PhylomeDBiQ6JQN1.
TreeFamiTF333953.

Family and domain databases

Gene3Di1.10.150.240. 1 hit.
1.10.540.10. 1 hit.
3.40.50.1000. 1 hit.
InterProiIPR006091. Acyl-CoA_Oxase/DH_cen-dom.
IPR009075. AcylCo_DH/oxidase_C.
IPR013786. AcylCoA_DH/ox_N.
IPR009100. AcylCoA_DH/oxidase_NM_dom.
IPR002575. Aminoglycoside_PTrfase.
IPR023214. HAD-like_dom.
IPR006439. HAD-SF_hydro_IA.
IPR011945. HAD-SF_ppase_IA/epoxid_hydro_N.
IPR011009. Kinase-like_dom.
IPR023198. PGP_dom2.
[Graphical view]
PfamiPF00441. Acyl-CoA_dh_1. 1 hit.
PF02770. Acyl-CoA_dh_M. 1 hit.
PF02771. Acyl-CoA_dh_N. 1 hit.
PF01636. APH. 1 hit.
PF13419. HAD_2. 1 hit.
[Graphical view]
PRINTSiPR00413. HADHALOGNASE.
SUPFAMiSSF47203. SSF47203. 1 hit.
SSF56112. SSF56112. 1 hit.
SSF56645. SSF56645. 1 hit.
SSF56784. SSF56784. 1 hit.
TIGRFAMsiTIGR02247. HAD-1A3-hyp. 1 hit.
TIGR01509. HAD-SF-IA-v3. 1 hit.

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6JQN1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MCVRSCFQSP RLQWVWRTAF LKHTQRRHQG SHRWTHLGGS TYRAVIFDMG
60 70 80 90 100
GVLIPSPGRV AAEWEVQNRI PSGTILKALM EGGENGPWMR FMRAEITAEG
110 120 130 140 150
FLREFGRLCS EMLKTSVPVD SFFSLLTSER VAKQFPVMTE AITQIRAKGL
160 170 180 190 200
QTAVLSNNFY LPNQKSFLPL DRKQFDVIVE SCMEGICKPD PRIYKLCLEQ
210 220 230 240 250
LGLQPSESIF LDDLGTNLKE AARLGIHTIK VNDPETAVKE LEALLGFTLR
260 270 280 290 300
VGVPNTRPVK KTMEIPKDSL QKYLKDLLGI QTTGPLELLQ FDHGQSNPTY
310 320 330 340 350
YIRLANRDLV LRKKPPGTLL PSAHAIEREF RIMKALANAG VPVPNVLDLC
360 370 380 390 400
EDSSVIGTPF YVMEYCPGLI YKDPSLPGLE PSHRRAIYTA MNTVLCKIHS
410 420 430 440 450
VDLQAVGLED YGKQGDYIPR QVRTWVKQYR ASETSTIPAM ERLIEWLPLH
460 470 480 490 500
LPRQQRTTVV HGDFRLDNLV FHPEEPEVLA VLDWELSTLG DPLADVAYSC
510 520 530 540 550
LAHYLPSSFP VLRGINDCDL TQLGIPAAEE YFRMYCLQMG LPPTENWNFY
560 570 580 590 600
MAFSFFRVAA ILQGVYKRSL TGQASSTYAE QTGKLTEFVS NLAWDFAVKE
610 620 630 640 650
GFRVFKEMPF TNPLTRSYHT WARPQSQWCP TGSRSYSSVP EASPAHTSRG
660 670 680 690 700
GLVISPESLS PPVRELYHRL KHFMEQRVYP AEPELQSHQA SAARWSPSPL
710 720 730 740 750
IEDLKEKAKA EGLWNLFLPL EADPEKKYGA GLTNVEYAHL CELMGTSLYA
760 770 780 790 800
PEVCNCSAPD TGNMELLVRY GTEAQKARWL IPLLEGKARS CFAMTEPQVA
810 820 830 840 850
SSDATNIEAS IREEDSFYVI NGHKWWITGI LDPRCQLCVF MGKTDPHAPR
860 870 880 890 900
HRQQSVLLVP MDTPGIKIIR PLTVYGLEDA PGGHGEVRFE HVRVPKENMV
910 920 930 940 950
LGPGRGFEIA QGRLGPGRIH HCMRLIGFSE RALALMKARV KSRLAFGKPL
960 970 980 990 1000
VEQGTVLADI AQSRVEIEQA RLLVLRAAHL MDLAGNKAAA LDIAMIKMVA
1010 1020 1030 1040 1050
PSMASRVIDR AIQAFGAAGL SSDYPLAQFF TWARALRFAD GPDEVHRATV

AKLELKHRI
Length:1,059
Mass (Da):118,834
Last modified:July 5, 2004 - v1
Checksum:iB8D4376FCF73D746
GO
Isoform 2 (identifier: Q6JQN1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     883-890: GHGEVRFE → CFLPSFSL
     891-1059: Missing.

Show »
Length:890
Mass (Da):100,352
Checksum:iA244BA80925C1BB4
GO
Isoform 3 (identifier: Q6JQN1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-398: Missing.
     399-413: HSVDLQAVGLEDYGK → MLEYLSLTFLISVKI
     883-890: GHGEVRFE → CFLPSFSL
     891-1059: Missing.

Note: No experimental confirmation available.
Show »
Length:492
Mass (Da):55,693
Checksum:i7D43DC0750659E9F
GO
Isoform 4 (identifier: Q6JQN1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     285-285: P → L
     286-1059: Missing.

Note: No experimental confirmation available.
Show »
Length:285
Mass (Da):32,196
Checksum:i8852125314974C50
GO
Isoform 5 (identifier: Q6JQN1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     230-230: K → KRQGFAVLPKLVSNSWAQAIYPPYPPKVVRLQ

Note: No experimental confirmation available.
Show »
Length:1,090
Mass (Da):122,340
Checksum:iE59653659AFD2629
GO

Sequence cautioni

The sequence AAH15056 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti124S → P in BAC03869 (PubMed:14702039).Curated1
Sequence conflicti197C → M in BAC05046 (PubMed:14702039).Curated1
Sequence conflicti511V → M in AL832043 (PubMed:17974005).Curated1
Sequence conflicti641E → D in AL832043 (PubMed:17974005).Curated1
Sequence conflicti663V → D in BAC03869 (PubMed:14702039).Curated1
Sequence conflicti688H → R in BAC03869 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_031811200Q → R.Corresponds to variant rs35276160dbSNPEnsembl.1
Natural variantiVAR_031812216T → P.Corresponds to variant rs35753710dbSNPEnsembl.1
Natural variantiVAR_031813463D → N.Corresponds to variant rs36046440dbSNPEnsembl.1
Natural variantiVAR_031814880A → V.Corresponds to variant rs34245489dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0246301 – 398Missing in isoform 3. 1 PublicationAdd BLAST398
Alternative sequenceiVSP_044980230K → KRQGFAVLPKLVSNSWAQAI YPPYPPKVVRLQ in isoform 5. 1 Publication1
Alternative sequenceiVSP_024631285P → L in isoform 4. 1 Publication1
Alternative sequenceiVSP_024632286 – 1059Missing in isoform 4. 1 PublicationAdd BLAST774
Alternative sequenceiVSP_024633399 – 413HSVDL…EDYGK → MLEYLSLTFLISVKI in isoform 3. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_024634883 – 890GHGEVRFE → CFLPSFSL in isoform 2 and isoform 3. 1 Publication8
Alternative sequenceiVSP_024635891 – 1059Missing in isoform 2 and isoform 3. 1 PublicationAdd BLAST169

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY323912 mRNA. Translation: AAQ88260.1.
AK092356 mRNA. Translation: BAC03869.1.
AK097425 mRNA. Translation: BAC05046.1.
AL832043 mRNA. No translation available.
AC002996 Genomic DNA. No translation available.
CH471054 Genomic DNA. Translation: EAW97962.1.
BC015056 mRNA. Translation: AAH15056.1. Different initiation.
BC126358 mRNA. Translation: AAI26359.1.
CCDSiCCDS31903.1. [Q6JQN1-1]
CCDS44973.1. [Q6JQN1-5]
RefSeqiNP_001130010.1. NM_001136538.1. [Q6JQN1-5]
NP_079523.3. NM_025247.5. [Q6JQN1-1]
UniGeneiHs.331141.

Genome annotation databases

EnsembliENST00000313698; ENSP00000325137; ENSG00000111271. [Q6JQN1-1]
ENST00000455480; ENSP00000389813; ENSG00000111271. [Q6JQN1-5]
GeneIDi80724.
KEGGihsa:80724.
UCSCiuc001tsq.4. human. [Q6JQN1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY323912 mRNA. Translation: AAQ88260.1.
AK092356 mRNA. Translation: BAC03869.1.
AK097425 mRNA. Translation: BAC05046.1.
AL832043 mRNA. No translation available.
AC002996 Genomic DNA. No translation available.
CH471054 Genomic DNA. Translation: EAW97962.1.
BC015056 mRNA. Translation: AAH15056.1. Different initiation.
BC126358 mRNA. Translation: AAI26359.1.
CCDSiCCDS31903.1. [Q6JQN1-1]
CCDS44973.1. [Q6JQN1-5]
RefSeqiNP_001130010.1. NM_001136538.1. [Q6JQN1-5]
NP_079523.3. NM_025247.5. [Q6JQN1-1]
UniGeneiHs.331141.

3D structure databases

ProteinModelPortaliQ6JQN1.
SMRiQ6JQN1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123274. 23 interactors.
IntActiQ6JQN1. 2 interactors.
STRINGi9606.ENSP00000389813.

PTM databases

iPTMnetiQ6JQN1.
PhosphoSitePlusiQ6JQN1.

Polymorphism and mutation databases

BioMutaiACAD10.
DMDMi74748862.

Proteomic databases

EPDiQ6JQN1.
MaxQBiQ6JQN1.
PaxDbiQ6JQN1.
PeptideAtlasiQ6JQN1.
PRIDEiQ6JQN1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000313698; ENSP00000325137; ENSG00000111271. [Q6JQN1-1]
ENST00000455480; ENSP00000389813; ENSG00000111271. [Q6JQN1-5]
GeneIDi80724.
KEGGihsa:80724.
UCSCiuc001tsq.4. human. [Q6JQN1-1]

Organism-specific databases

CTDi80724.
DisGeNETi80724.
GeneCardsiACAD10.
HGNCiHGNC:21597. ACAD10.
HPAiHPA067222.
MIMi611181. gene.
neXtProtiNX_Q6JQN1.
OpenTargetsiENSG00000111271.
PharmGKBiPA134976754.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1469. Eukaryota.
KOG3085. Eukaryota.
COG3173. LUCA.
GeneTreeiENSGT00760000119007.
HOGENOMiHOG000131666.
HOVERGENiHBG057142.
InParanoidiQ6JQN1.
KOiK11729.
OMAiAIGLQKY.
OrthoDBiEOG091G03B8.
PhylomeDBiQ6JQN1.
TreeFamiTF333953.

Enzyme and pathway databases

ReactomeiR-HSA-77289. Mitochondrial Fatty Acid Beta-Oxidation.

Miscellaneous databases

ChiTaRSiACAD10. human.
GenomeRNAii80724.
PROiQ6JQN1.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000111271.
CleanExiHS_ACAD10.
ExpressionAtlasiQ6JQN1. baseline and differential.
GenevisibleiQ6JQN1. HS.

Family and domain databases

Gene3Di1.10.150.240. 1 hit.
1.10.540.10. 1 hit.
3.40.50.1000. 1 hit.
InterProiIPR006091. Acyl-CoA_Oxase/DH_cen-dom.
IPR009075. AcylCo_DH/oxidase_C.
IPR013786. AcylCoA_DH/ox_N.
IPR009100. AcylCoA_DH/oxidase_NM_dom.
IPR002575. Aminoglycoside_PTrfase.
IPR023214. HAD-like_dom.
IPR006439. HAD-SF_hydro_IA.
IPR011945. HAD-SF_ppase_IA/epoxid_hydro_N.
IPR011009. Kinase-like_dom.
IPR023198. PGP_dom2.
[Graphical view]
PfamiPF00441. Acyl-CoA_dh_1. 1 hit.
PF02770. Acyl-CoA_dh_M. 1 hit.
PF02771. Acyl-CoA_dh_N. 1 hit.
PF01636. APH. 1 hit.
PF13419. HAD_2. 1 hit.
[Graphical view]
PRINTSiPR00413. HADHALOGNASE.
SUPFAMiSSF47203. SSF47203. 1 hit.
SSF56112. SSF56112. 1 hit.
SSF56645. SSF56645. 1 hit.
SSF56784. SSF56784. 1 hit.
TIGRFAMsiTIGR02247. HAD-1A3-hyp. 1 hit.
TIGR01509. HAD-SF-IA-v3. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiACD10_HUMAN
AccessioniPrimary (citable) accession number: Q6JQN1
Secondary accession number(s): G3XAJ0
, Q8N828, Q8NAP2, Q96BX5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: July 5, 2004
Last modified: November 2, 2016
This is version 119 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.