Q6JQN1 (ACD10_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 86.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Acyl-CoA dehydrogenase family member 10 Short name=ACAD-10 EC=1.3.99.- | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1059 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Acyl-CoA dehydrogenase only active with R- and S-2-methyl-C15-CoA. Ref.7 |
| Catalytic activity | Acyl-CoA + acceptor = 2,3-dehydroacyl-CoA + reduced acceptor. |
| Cofactor | FAD By similarity. |
| Tissue specificity | Widely expressed with highest expression in fetal brain, followed by heart, muscle, kidney and adult brain. Expression levels varying from isoform to isoform. Ref.1 Ref.7 |
| Sequence similarities | Belongs to the acyl-CoA dehydrogenase family. |
| Sequence caution | The sequence AAH15056.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | FAD Flavoprotein |
| Molecular function | Oxidoreductase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | mitochondrion Non-traceable author statement Ref.7. Source: UniProtKB |
| Molecular_function | acyl-CoA dehydrogenase activity Inferred from electronic annotation. Source: InterPro flavin adenine dinucleotide bindingInferred from electronic annotation. Source: InterPro hydrolase activityInferred from electronic annotation. Source: InterPro transferase activity, transferring phosphorus-containing groupsInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6JQN1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6JQN1-2) The sequence of this isoform differs from the canonical sequence as follows: 883-890: GHGEVRFE → CFLPSFSL 891-1059: Missing. | ||||||
| Isoform 3 (identifier: Q6JQN1-3) The sequence of this isoform differs from the canonical sequence as follows: 1-398: Missing. 399-413: HSVDLQAVGLEDYGK → MLEYLSLTFLISVKI 883-890: GHGEVRFE → CFLPSFSL 891-1059: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q6JQN1-4) The sequence of this isoform differs from the canonical sequence as follows: 285-285: P → L 286-1059: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q6JQN1-5) The sequence of this isoform differs from the canonical sequence as follows: 230-230: K → KRQGFAVLPKLVSNSWAQAIYPPYPPKVVRLQ | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1059 | 1059 | Acyl-CoA dehydrogenase family member 10 | PRO_0000284770 | |||||
Regions | |||||||||
| Nucleotide binding | 792 – 802 | 11 | FAD By similarity | ||||||
Sites | |||||||||
| Binding site | 828 | 1 | FAD By similarity | ||||||
| Binding site | 943 | 1 | FAD By similarity | ||||||
| Binding site | 1013 | 1 | FAD By similarity | ||||||
| Binding site | 1044 | 1 | FAD By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 398 | 398 | Missing in isoform 3. | VSP_024630 | |||||
| Alternative sequence | 230 | 1 | K → KRQGFAVLPKLVSNSWAQAI YPPYPPKVVRLQ in isoform 5. | VSP_044980 | |||||
| Alternative sequence | 285 | 1 | P → L in isoform 4. | VSP_024631 | |||||
| Alternative sequence | 286 – 1059 | 774 | Missing in isoform 4. | VSP_024632 | |||||
| Alternative sequence | 399 – 413 | 15 | HSVDL…EDYGK → MLEYLSLTFLISVKI in isoform 3. | VSP_024633 | |||||
| Alternative sequence | 883 – 890 | 8 | GHGEVRFE → CFLPSFSL in isoform 2 and isoform 3. | VSP_024634 | |||||
| Alternative sequence | 891 – 1059 | 169 | Missing in isoform 2 and isoform 3. | VSP_024635 | |||||
| Natural variant | 200 | 1 | Q → R. Corresponds to variant rs35276160 [ dbSNP | Ensembl ]. | VAR_031811 | |||||
| Natural variant | 216 | 1 | T → P. Corresponds to variant rs35753710 [ dbSNP | Ensembl ]. | VAR_031812 | |||||
| Natural variant | 463 | 1 | D → N. Corresponds to variant rs36046440 [ dbSNP | Ensembl ]. | VAR_031813 | |||||
| Natural variant | 880 | 1 | A → V. Corresponds to variant rs34245489 [ dbSNP | Ensembl ]. | VAR_031814 | |||||
Experimental info | |||||||||
| Sequence conflict | 124 | 1 | S → P in BAC03869. Ref.2 | ||||||
| Sequence conflict | 197 | 1 | C → M in BAC05046. Ref.2 | ||||||
| Sequence conflict | 511 | 1 | V → M in AL832043. Ref.3 | ||||||
| Sequence conflict | 641 | 1 | E → D in AL832043. Ref.3 | ||||||
| Sequence conflict | 663 | 1 | V → D in BAC03869. Ref.2 | ||||||
| Sequence conflict | 688 | 1 | H → R in BAC03869. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY323912 mRNA. Translation: AAQ88260.1. AK092356 mRNA. Translation: BAC03869.1. AK097425 mRNA. Translation: BAC05046.1. AL832043 mRNA. No translation available. AC002996 Genomic DNA. No translation available. CH471054 Genomic DNA. Translation: EAW97962.1. BC015056 mRNA. Translation: AAH15056.1. Different initiation. BC126358 mRNA. Translation: AAI26359.1. |
| IPI | IPI00418639. IPI00797832. IPI00843833. IPI00843880. |
| RefSeq | NP_001130010.1. NM_001136538.1. NP_079523.3. NM_025247.5. |
| UniGene | Hs.331141. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1Z4O based on UniProtKB P71447. |
| ProteinModelPortal | Q6JQN1. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q6JQN1. 1 interaction. |
| STRING | 9606.ENSP00000389813. |
PTM databases | |
| PhosphoSite | Q6JQN1. |
Polymorphism databases | |
| DMDM | 74748862. |
Proteomic databases | |
| PaxDb | Q6JQN1. |
| PRIDE | Q6JQN1. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000313698; ENSP00000325137; ENSG00000111271. ENST00000392636; ENSP00000376411; ENSG00000111271. ENST00000413681; ENSP00000405390; ENSG00000111271. ENST00000455480; ENSP00000389813; ENSG00000111271. ENST00000507135; ENSP00000446585; ENSG00000111271. |
| GeneID | 80724. |
| KEGG | hsa:80724. |
| UCSC | uc001tso.4. human. uc001tsp.3. human. uc001tsq.3. human. |
Organism-specific databases | |
| CTD | 80724. |
| GeneCards | GC12P112123. |
| HGNC | HGNC:21597. ACAD10. |
| MIM | 611181. gene. |
| neXtProt | NX_Q6JQN1. |
| PharmGKB | PA134976754. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG1011. |
| HOGENOM | HOG000131666. |
| HOVERGEN | HBG057142. |
| InParanoid | Q6JQN1. |
| KO | K11729. |
| OMA | CMRLIGF. |
Gene expression databases | |
| ArrayExpress | Q6JQN1. |
| Bgee | Q6JQN1. |
| CleanEx | HS_ACAD10. |
| Genevestigator | Q6JQN1. |
Family and domain databases | |
| Gene3D | 1.10.150.240. 1 hit. 1.10.540.10. 1 hit. 2.40.110.10. 1 hit. 3.40.50.1000. 1 hit. |
| InterPro | IPR006092. Acyl-CoA_DH_N. IPR006090. Acyl-CoA_Oxase/DH_1. IPR006091. Acyl-CoA_Oxase/DH_cen-dom. IPR009075. AcylCo_DH/oxidase_C. IPR013786. AcylCoA_DH/ox_N. IPR009100. AcylCoA_DH/oxidase. IPR002575. Aminoglycoside_PTrfase. IPR023214. HAD-like_dom. IPR006402. HAD-SF_hydro_IA_v3. IPR011945. HAD-SF_ppase_IA/epoxid_hydro_N. IPR005833. Haloacid_DH/epoxide_hydro. IPR011009. Kinase-like_dom. IPR023198. PGP_dom2. [Graphical view] |
| Pfam | PF00441. Acyl-CoA_dh_1. 1 hit. PF02770. Acyl-CoA_dh_M. 1 hit. PF02771. Acyl-CoA_dh_N. 1 hit. PF01636. APH. 1 hit. PF13419. HAD_2. 1 hit. [Graphical view] |
| PRINTS | PR00413. HADHALOGNASE. |
| SUPFAM | SSF56645. AcylCoA_dehyd_NM. 1 hit. SSF47203. AcylCoADH_C_like. 1 hit. SSF56784. HAD-like_dom. 1 hit. SSF56112. Kinase_like. 1 hit. |
| TIGRFAMs | TIGR02247. HAD-1A3-hyp. 1 hit. TIGR01509. HAD-SF-IA-v3. 1 hit. |
| PROSITE | PS00072. ACYL_COA_DH_1. False negative. PS00073. ACYL_COA_DH_2. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 80724. |
| NextBio | 71031. |
| SOURCE | Search... |
Entry information
| Entry name | ACD10_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6JQN1 Secondary accession number(s): G3XAJ0 Q96BX5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
