Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q6JQN1 (ACD10_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 95. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Acyl-CoA dehydrogenase family member 10

Short name=ACAD-10
EC=1.3.99.-
Gene names
Name:ACAD10
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1059 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Acyl-CoA dehydrogenase only active with R- and S-2-methyl-C15-CoA. Ref.7

Catalytic activity

Acyl-CoA + acceptor = 2,3-dehydroacyl-CoA + reduced acceptor.

Cofactor

FAD By similarity.

Tissue specificity

Widely expressed with highest expression in fetal brain, followed by heart, muscle, kidney and adult brain. Expression levels varying from isoform toisoform. Ref.1 Ref.7

Sequence similarities

Belongs to the acyl-CoA dehydrogenase family.

Sequence caution

The sequence AAH15056.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q6JQN1-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q6JQN1-2)

The sequence of this isoform differs from the canonical sequence as follows:
     883-890: GHGEVRFE → CFLPSFSL
     891-1059: Missing.
Isoform 3 (identifier: Q6JQN1-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-398: Missing.
     399-413: HSVDLQAVGLEDYGK → MLEYLSLTFLISVKI
     883-890: GHGEVRFE → CFLPSFSL
     891-1059: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: Q6JQN1-4)

The sequence of this isoform differs from the canonical sequence as follows:
     285-285: P → L
     286-1059: Missing.
Note: No experimental confirmation available.
Isoform 5 (identifier: Q6JQN1-5)

The sequence of this isoform differs from the canonical sequence as follows:
     230-230: K → KRQGFAVLPKLVSNSWAQAIYPPYPPKVVRLQ
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 10591059Acyl-CoA dehydrogenase family member 10
PRO_0000284770

Regions

Nucleotide binding792 – 80211FAD By similarity

Sites

Binding site8281FAD By similarity
Binding site9431FAD By similarity
Binding site10131FAD By similarity
Binding site10441FAD By similarity

Amino acid modifications

Modified residue4131N6-succinyllysine By similarity
Modified residue4271N6-acetyllysine; alternate By similarity
Modified residue4271N6-succinyllysine; alternate By similarity
Modified residue10521N6-acetyllysine; alternate By similarity
Modified residue10521N6-succinyllysine; alternate By similarity

Natural variations

Alternative sequence1 – 398398Missing in isoform 3.
VSP_024630
Alternative sequence2301K → KRQGFAVLPKLVSNSWAQAI YPPYPPKVVRLQ in isoform 5.
VSP_044980
Alternative sequence2851P → L in isoform 4.
VSP_024631
Alternative sequence286 – 1059774Missing in isoform 4.
VSP_024632
Alternative sequence399 – 41315HSVDL…EDYGK → MLEYLSLTFLISVKI in isoform 3.
VSP_024633
Alternative sequence883 – 8908GHGEVRFE → CFLPSFSL in isoform 2 and isoform 3.
VSP_024634
Alternative sequence891 – 1059169Missing in isoform 2 and isoform 3.
VSP_024635
Natural variant2001Q → R.
Corresponds to variant rs35276160 [ dbSNP | Ensembl ].
VAR_031811
Natural variant2161T → P.
Corresponds to variant rs35753710 [ dbSNP | Ensembl ].
VAR_031812
Natural variant4631D → N.
Corresponds to variant rs36046440 [ dbSNP | Ensembl ].
VAR_031813
Natural variant8801A → V.
Corresponds to variant rs34245489 [ dbSNP | Ensembl ].
VAR_031814

Experimental info

Sequence conflict1241S → P in BAC03869. Ref.2
Sequence conflict1971C → M in BAC05046. Ref.2
Sequence conflict5111V → M in AL832043. Ref.3
Sequence conflict6411E → D in AL832043. Ref.3
Sequence conflict6631V → D in BAC03869. Ref.2
Sequence conflict6881H → R in BAC03869. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 5, 2004. Version 1.
Checksum: B8D4376FCF73D746

FASTA1,059118,834
        10         20         30         40         50         60 
MCVRSCFQSP RLQWVWRTAF LKHTQRRHQG SHRWTHLGGS TYRAVIFDMG GVLIPSPGRV 

        70         80         90        100        110        120 
AAEWEVQNRI PSGTILKALM EGGENGPWMR FMRAEITAEG FLREFGRLCS EMLKTSVPVD 

       130        140        150        160        170        180 
SFFSLLTSER VAKQFPVMTE AITQIRAKGL QTAVLSNNFY LPNQKSFLPL DRKQFDVIVE 

       190        200        210        220        230        240 
SCMEGICKPD PRIYKLCLEQ LGLQPSESIF LDDLGTNLKE AARLGIHTIK VNDPETAVKE 

       250        260        270        280        290        300 
LEALLGFTLR VGVPNTRPVK KTMEIPKDSL QKYLKDLLGI QTTGPLELLQ FDHGQSNPTY 

       310        320        330        340        350        360 
YIRLANRDLV LRKKPPGTLL PSAHAIEREF RIMKALANAG VPVPNVLDLC EDSSVIGTPF 

       370        380        390        400        410        420 
YVMEYCPGLI YKDPSLPGLE PSHRRAIYTA MNTVLCKIHS VDLQAVGLED YGKQGDYIPR 

       430        440        450        460        470        480 
QVRTWVKQYR ASETSTIPAM ERLIEWLPLH LPRQQRTTVV HGDFRLDNLV FHPEEPEVLA 

       490        500        510        520        530        540 
VLDWELSTLG DPLADVAYSC LAHYLPSSFP VLRGINDCDL TQLGIPAAEE YFRMYCLQMG 

       550        560        570        580        590        600 
LPPTENWNFY MAFSFFRVAA ILQGVYKRSL TGQASSTYAE QTGKLTEFVS NLAWDFAVKE 

       610        620        630        640        650        660 
GFRVFKEMPF TNPLTRSYHT WARPQSQWCP TGSRSYSSVP EASPAHTSRG GLVISPESLS 

       670        680        690        700        710        720 
PPVRELYHRL KHFMEQRVYP AEPELQSHQA SAARWSPSPL IEDLKEKAKA EGLWNLFLPL 

       730        740        750        760        770        780 
EADPEKKYGA GLTNVEYAHL CELMGTSLYA PEVCNCSAPD TGNMELLVRY GTEAQKARWL 

       790        800        810        820        830        840 
IPLLEGKARS CFAMTEPQVA SSDATNIEAS IREEDSFYVI NGHKWWITGI LDPRCQLCVF 

       850        860        870        880        890        900 
MGKTDPHAPR HRQQSVLLVP MDTPGIKIIR PLTVYGLEDA PGGHGEVRFE HVRVPKENMV 

       910        920        930        940        950        960 
LGPGRGFEIA QGRLGPGRIH HCMRLIGFSE RALALMKARV KSRLAFGKPL VEQGTVLADI 

       970        980        990       1000       1010       1020 
AQSRVEIEQA RLLVLRAAHL MDLAGNKAAA LDIAMIKMVA PSMASRVIDR AIQAFGAAGL 

      1030       1040       1050 
SSDYPLAQFF TWARALRFAD GPDEVHRATV AKLELKHRI 

« Hide

Isoform 2 [UniParc].

Checksum: A244BA80925C1BB4
Show »

FASTA890100,352
Isoform 3 [UniParc].

Checksum: 7D43DC0750659E9F
Show »

FASTA49255,693
Isoform 4 [UniParc].

Checksum: 8852125314974C50
Show »

FASTA28532,196
Isoform 5 [UniParc].

Checksum: E59653659AFD2629
Show »

FASTA1,090122,340

References

« Hide 'large scale' references
[1]"Cloning and characterization of a human cDNA ACAD10 mapped to chromosome 12q24.1."
Ye X., Ji C., Zhou C., Zeng L., Gu S., Ying K., Xie Y., Mao Y.
Mol. Biol. Rep. 31:191-195(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
Tissue: Fetal brain.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
Tissue: Brain and Testis.
[3]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
Tissue: Bone marrow.
[4]"The finished DNA sequence of human chromosome 12."
Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. expand/collapse author list , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4).
Tissue: Skin.
[7]"Identification and characterization of new long chain acyl-CoA dehydrogenases."
He M., Pei Z., Mohsen A.W., Watkins P., Murdoch G., Van Veldhoven P.P., Ensenauer R., Vockley J.
Mol. Genet. Metab. 102:418-429(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, TISSUE SPECIFICITY.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY323912 mRNA. Translation: AAQ88260.1.
AK092356 mRNA. Translation: BAC03869.1.
AK097425 mRNA. Translation: BAC05046.1.
AL832043 mRNA. No translation available.
AC002996 Genomic DNA. No translation available.
CH471054 Genomic DNA. Translation: EAW97962.1.
BC015056 mRNA. Translation: AAH15056.1. Different initiation.
BC126358 mRNA. Translation: AAI26359.1.
RefSeqNP_001130010.1. NM_001136538.1.
NP_079523.3. NM_025247.5.
UniGeneHs.331141.

3D structure databases

ProteinModelPortalQ6JQN1.
SMRQ6JQN1. Positions 41-261, 284-599, 659-1055.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid123274. 2 interactions.
IntActQ6JQN1. 1 interaction.
STRING9606.ENSP00000389813.

PTM databases

PhosphoSiteQ6JQN1.

Polymorphism databases

DMDM74748862.

Proteomic databases

PaxDbQ6JQN1.
PRIDEQ6JQN1.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000313698; ENSP00000325137; ENSG00000111271. [Q6JQN1-1]
ENST00000392636; ENSP00000376411; ENSG00000111271. [Q6JQN1-3]
ENST00000455480; ENSP00000389813; ENSG00000111271. [Q6JQN1-5]
GeneID80724.
KEGGhsa:80724.
UCSCuc001tso.4. human. [Q6JQN1-4]
uc001tsp.3. human. [Q6JQN1-2]
uc001tsq.3. human. [Q6JQN1-1]
uc009zvx.3. human.

Organism-specific databases

CTD80724.
GeneCardsGC12P112123.
HGNCHGNC:21597. ACAD10.
MIM611181. gene.
neXtProtNX_Q6JQN1.
PharmGKBPA134976754.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG1011.
HOGENOMHOG000131666.
HOVERGENHBG057142.
InParanoidQ6JQN1.
KOK11729.
OMACMRLIGF.
OrthoDBEOG7JDQWS.
PhylomeDBQ6JQN1.
TreeFamTF333953.

Gene expression databases

ArrayExpressQ6JQN1.
BgeeQ6JQN1.
CleanExHS_ACAD10.
GenevestigatorQ6JQN1.

Family and domain databases

Gene3D1.10.150.240. 1 hit.
1.10.540.10. 1 hit.
2.40.110.10. 1 hit.
3.40.50.1000. 1 hit.
InterProIPR006091. Acyl-CoA_Oxase/DH_cen-dom.
IPR009075. AcylCo_DH/oxidase_C.
IPR013786. AcylCoA_DH/ox_N.
IPR009100. AcylCoA_DH/oxidase_NM_dom.
IPR002575. Aminoglycoside_PTrfase.
IPR023214. HAD-like_dom.
IPR006439. HAD-SF_hydro_IA.
IPR011945. HAD-SF_ppase_IA/epoxid_hydro_N.
IPR011009. Kinase-like_dom.
IPR023198. PGP_dom2.
[Graphical view]
PfamPF00441. Acyl-CoA_dh_1. 1 hit.
PF02770. Acyl-CoA_dh_M. 1 hit.
PF02771. Acyl-CoA_dh_N. 1 hit.
PF01636. APH. 1 hit.
PF13419. HAD_2. 1 hit.
[Graphical view]
PRINTSPR00413. HADHALOGNASE.
SUPFAMSSF47203. SSF47203. 1 hit.
SSF56112. SSF56112. 1 hit.
SSF56645. SSF56645. 1 hit.
SSF56784. SSF56784. 1 hit.
TIGRFAMsTIGR02247. HAD-1A3-hyp. 1 hit.
TIGR01509. HAD-SF-IA-v3. 1 hit.
ProtoNetSearch...

Other

GenomeRNAi80724.
NextBio71031.
PROQ6JQN1.
SOURCESearch...

Entry information

Entry nameACD10_HUMAN
AccessionPrimary (citable) accession number: Q6JQN1
Secondary accession number(s): G3XAJ0 expand/collapse secondary AC list , Q8N828, Q8NAP2, Q96BX5
Entry history
Integrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: July 5, 2004
Last modified: April 16, 2014
This is version 95 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 12

Human chromosome 12: entries, gene names and cross-references to MIM