Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6JQN1

- ACD10_HUMAN

UniProt

Q6JQN1 - ACD10_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Acyl-CoA dehydrogenase family member 10

Gene

ACAD10

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

Acyl-CoA dehydrogenase only active with R- and S-2-methyl-C15-CoA.1 Publication

Catalytic activityi

Acyl-CoA + acceptor = 2,3-dehydroacyl-CoA + reduced acceptor.

Cofactori

FAD.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei828 – 8281FADBy similarity
Binding sitei943 – 9431FADBy similarity
Binding sitei1013 – 10131FADBy similarity
Binding sitei1044 – 10441FADBy similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi792 – 80211FADBy similarityAdd
BLAST

GO - Molecular functioni

  1. acyl-CoA dehydrogenase activity Source: InterPro
  2. flavin adenine dinucleotide binding Source: InterPro
  3. hydrolase activity Source: InterPro
  4. transferase activity, transferring phosphorus-containing groups Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Oxidoreductase

Keywords - Ligandi

FAD, Flavoprotein

Names & Taxonomyi

Protein namesi
Recommended name:
Acyl-CoA dehydrogenase family member 10 (EC:1.3.99.-)
Short name:
ACAD-10
Gene namesi
Name:ACAD10
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:21597. ACAD10.

Subcellular locationi

GO - Cellular componenti

  1. mitochondrion Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134976754.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10591059Acyl-CoA dehydrogenase family member 10PRO_0000284770Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei413 – 4131N6-succinyllysineBy similarity
Modified residuei427 – 4271N6-acetyllysine; alternateBy similarity
Modified residuei427 – 4271N6-succinyllysine; alternateBy similarity
Modified residuei1052 – 10521N6-acetyllysine; alternateBy similarity
Modified residuei1052 – 10521N6-succinyllysine; alternateBy similarity

Keywords - PTMi

Acetylation

Proteomic databases

MaxQBiQ6JQN1.
PaxDbiQ6JQN1.
PRIDEiQ6JQN1.

PTM databases

PhosphoSiteiQ6JQN1.

Expressioni

Tissue specificityi

Widely expressed with highest expression in fetal brain, followed by heart, muscle, kidney and adult brain. Expression levels varying from isoform to isoform.2 Publications

Gene expression databases

BgeeiQ6JQN1.
CleanExiHS_ACAD10.
ExpressionAtlasiQ6JQN1. baseline.
GenevestigatoriQ6JQN1.

Interactioni

Protein-protein interaction databases

BioGridi123274. 6 interactions.
IntActiQ6JQN1. 1 interaction.
STRINGi9606.ENSP00000389813.

Structurei

3D structure databases

ProteinModelPortaliQ6JQN1.
SMRiQ6JQN1. Positions 43-249, 284-599, 659-1055.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the acyl-CoA dehydrogenase family.Curated

Phylogenomic databases

eggNOGiCOG1011.
GeneTreeiENSGT00760000119007.
HOGENOMiHOG000131666.
HOVERGENiHBG057142.
InParanoidiQ6JQN1.
KOiK11729.
OMAiCMRLIGF.
OrthoDBiEOG7JDQWS.
PhylomeDBiQ6JQN1.
TreeFamiTF333953.

Family and domain databases

Gene3Di1.10.150.240. 1 hit.
1.10.540.10. 1 hit.
2.40.110.10. 1 hit.
3.40.50.1000. 1 hit.
InterProiIPR006091. Acyl-CoA_Oxase/DH_cen-dom.
IPR009075. AcylCo_DH/oxidase_C.
IPR013786. AcylCoA_DH/ox_N.
IPR009100. AcylCoA_DH/oxidase_NM_dom.
IPR002575. Aminoglycoside_PTrfase.
IPR023214. HAD-like_dom.
IPR006439. HAD-SF_hydro_IA.
IPR011945. HAD-SF_ppase_IA/epoxid_hydro_N.
IPR011009. Kinase-like_dom.
IPR023198. PGP_dom2.
[Graphical view]
PfamiPF00441. Acyl-CoA_dh_1. 1 hit.
PF02770. Acyl-CoA_dh_M. 1 hit.
PF02771. Acyl-CoA_dh_N. 1 hit.
PF01636. APH. 1 hit.
PF13419. HAD_2. 1 hit.
[Graphical view]
PRINTSiPR00413. HADHALOGNASE.
SUPFAMiSSF47203. SSF47203. 1 hit.
SSF56112. SSF56112. 1 hit.
SSF56645. SSF56645. 1 hit.
SSF56784. SSF56784. 1 hit.
TIGRFAMsiTIGR02247. HAD-1A3-hyp. 1 hit.
TIGR01509. HAD-SF-IA-v3. 1 hit.

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6JQN1-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MCVRSCFQSP RLQWVWRTAF LKHTQRRHQG SHRWTHLGGS TYRAVIFDMG
60 70 80 90 100
GVLIPSPGRV AAEWEVQNRI PSGTILKALM EGGENGPWMR FMRAEITAEG
110 120 130 140 150
FLREFGRLCS EMLKTSVPVD SFFSLLTSER VAKQFPVMTE AITQIRAKGL
160 170 180 190 200
QTAVLSNNFY LPNQKSFLPL DRKQFDVIVE SCMEGICKPD PRIYKLCLEQ
210 220 230 240 250
LGLQPSESIF LDDLGTNLKE AARLGIHTIK VNDPETAVKE LEALLGFTLR
260 270 280 290 300
VGVPNTRPVK KTMEIPKDSL QKYLKDLLGI QTTGPLELLQ FDHGQSNPTY
310 320 330 340 350
YIRLANRDLV LRKKPPGTLL PSAHAIEREF RIMKALANAG VPVPNVLDLC
360 370 380 390 400
EDSSVIGTPF YVMEYCPGLI YKDPSLPGLE PSHRRAIYTA MNTVLCKIHS
410 420 430 440 450
VDLQAVGLED YGKQGDYIPR QVRTWVKQYR ASETSTIPAM ERLIEWLPLH
460 470 480 490 500
LPRQQRTTVV HGDFRLDNLV FHPEEPEVLA VLDWELSTLG DPLADVAYSC
510 520 530 540 550
LAHYLPSSFP VLRGINDCDL TQLGIPAAEE YFRMYCLQMG LPPTENWNFY
560 570 580 590 600
MAFSFFRVAA ILQGVYKRSL TGQASSTYAE QTGKLTEFVS NLAWDFAVKE
610 620 630 640 650
GFRVFKEMPF TNPLTRSYHT WARPQSQWCP TGSRSYSSVP EASPAHTSRG
660 670 680 690 700
GLVISPESLS PPVRELYHRL KHFMEQRVYP AEPELQSHQA SAARWSPSPL
710 720 730 740 750
IEDLKEKAKA EGLWNLFLPL EADPEKKYGA GLTNVEYAHL CELMGTSLYA
760 770 780 790 800
PEVCNCSAPD TGNMELLVRY GTEAQKARWL IPLLEGKARS CFAMTEPQVA
810 820 830 840 850
SSDATNIEAS IREEDSFYVI NGHKWWITGI LDPRCQLCVF MGKTDPHAPR
860 870 880 890 900
HRQQSVLLVP MDTPGIKIIR PLTVYGLEDA PGGHGEVRFE HVRVPKENMV
910 920 930 940 950
LGPGRGFEIA QGRLGPGRIH HCMRLIGFSE RALALMKARV KSRLAFGKPL
960 970 980 990 1000
VEQGTVLADI AQSRVEIEQA RLLVLRAAHL MDLAGNKAAA LDIAMIKMVA
1010 1020 1030 1040 1050
PSMASRVIDR AIQAFGAAGL SSDYPLAQFF TWARALRFAD GPDEVHRATV

AKLELKHRI
Length:1,059
Mass (Da):118,834
Last modified:July 5, 2004 - v1
Checksum:iB8D4376FCF73D746
GO
Isoform 2 (identifier: Q6JQN1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     883-890: GHGEVRFE → CFLPSFSL
     891-1059: Missing.

Show »
Length:890
Mass (Da):100,352
Checksum:iA244BA80925C1BB4
GO
Isoform 3 (identifier: Q6JQN1-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-398: Missing.
     399-413: HSVDLQAVGLEDYGK → MLEYLSLTFLISVKI
     883-890: GHGEVRFE → CFLPSFSL
     891-1059: Missing.

Note: No experimental confirmation available.

Show »
Length:492
Mass (Da):55,693
Checksum:i7D43DC0750659E9F
GO
Isoform 4 (identifier: Q6JQN1-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     285-285: P → L
     286-1059: Missing.

Note: No experimental confirmation available.

Show »
Length:285
Mass (Da):32,196
Checksum:i8852125314974C50
GO
Isoform 5 (identifier: Q6JQN1-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     230-230: K → KRQGFAVLPKLVSNSWAQAIYPPYPPKVVRLQ

Note: No experimental confirmation available.

Show »
Length:1,090
Mass (Da):122,340
Checksum:iE59653659AFD2629
GO

Sequence cautioni

The sequence AAH15056.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti124 – 1241S → P in BAC03869. (PubMed:14702039)Curated
Sequence conflicti197 – 1971C → M in BAC05046. (PubMed:14702039)Curated
Sequence conflicti511 – 5111V → M in AL832043. (PubMed:17974005)Curated
Sequence conflicti641 – 6411E → D in AL832043. (PubMed:17974005)Curated
Sequence conflicti663 – 6631V → D in BAC03869. (PubMed:14702039)Curated
Sequence conflicti688 – 6881H → R in BAC03869. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti200 – 2001Q → R.
Corresponds to variant rs35276160 [ dbSNP | Ensembl ].
VAR_031811
Natural varianti216 – 2161T → P.
Corresponds to variant rs35753710 [ dbSNP | Ensembl ].
VAR_031812
Natural varianti463 – 4631D → N.
Corresponds to variant rs36046440 [ dbSNP | Ensembl ].
VAR_031813
Natural varianti880 – 8801A → V.
Corresponds to variant rs34245489 [ dbSNP | Ensembl ].
VAR_031814

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 398398Missing in isoform 3. 1 PublicationVSP_024630Add
BLAST
Alternative sequencei230 – 2301K → KRQGFAVLPKLVSNSWAQAI YPPYPPKVVRLQ in isoform 5. 1 PublicationVSP_044980
Alternative sequencei285 – 2851P → L in isoform 4. 1 PublicationVSP_024631
Alternative sequencei286 – 1059774Missing in isoform 4. 1 PublicationVSP_024632Add
BLAST
Alternative sequencei399 – 41315HSVDL…EDYGK → MLEYLSLTFLISVKI in isoform 3. 1 PublicationVSP_024633Add
BLAST
Alternative sequencei883 – 8908GHGEVRFE → CFLPSFSL in isoform 2 and isoform 3. 1 PublicationVSP_024634
Alternative sequencei891 – 1059169Missing in isoform 2 and isoform 3. 1 PublicationVSP_024635Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY323912 mRNA. Translation: AAQ88260.1.
AK092356 mRNA. Translation: BAC03869.1.
AK097425 mRNA. Translation: BAC05046.1.
AL832043 mRNA. No translation available.
AC002996 Genomic DNA. No translation available.
CH471054 Genomic DNA. Translation: EAW97962.1.
BC015056 mRNA. Translation: AAH15056.1. Different initiation.
BC126358 mRNA. Translation: AAI26359.1.
CCDSiCCDS31903.1. [Q6JQN1-1]
CCDS44973.1. [Q6JQN1-5]
RefSeqiNP_001130010.1. NM_001136538.1. [Q6JQN1-5]
NP_079523.3. NM_025247.5. [Q6JQN1-1]
UniGeneiHs.331141.

Genome annotation databases

EnsembliENST00000313698; ENSP00000325137; ENSG00000111271. [Q6JQN1-1]
ENST00000455480; ENSP00000389813; ENSG00000111271. [Q6JQN1-5]
GeneIDi80724.
KEGGihsa:80724.
UCSCiuc001tso.4. human. [Q6JQN1-4]
uc001tsp.3. human. [Q6JQN1-2]
uc001tsq.3. human. [Q6JQN1-1]
uc009zvx.3. human.

Polymorphism databases

DMDMi74748862.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY323912 mRNA. Translation: AAQ88260.1 .
AK092356 mRNA. Translation: BAC03869.1 .
AK097425 mRNA. Translation: BAC05046.1 .
AL832043 mRNA. No translation available.
AC002996 Genomic DNA. No translation available.
CH471054 Genomic DNA. Translation: EAW97962.1 .
BC015056 mRNA. Translation: AAH15056.1 . Different initiation.
BC126358 mRNA. Translation: AAI26359.1 .
CCDSi CCDS31903.1. [Q6JQN1-1 ]
CCDS44973.1. [Q6JQN1-5 ]
RefSeqi NP_001130010.1. NM_001136538.1. [Q6JQN1-5 ]
NP_079523.3. NM_025247.5. [Q6JQN1-1 ]
UniGenei Hs.331141.

3D structure databases

ProteinModelPortali Q6JQN1.
SMRi Q6JQN1. Positions 43-249, 284-599, 659-1055.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 123274. 6 interactions.
IntActi Q6JQN1. 1 interaction.
STRINGi 9606.ENSP00000389813.

PTM databases

PhosphoSitei Q6JQN1.

Polymorphism databases

DMDMi 74748862.

Proteomic databases

MaxQBi Q6JQN1.
PaxDbi Q6JQN1.
PRIDEi Q6JQN1.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000313698 ; ENSP00000325137 ; ENSG00000111271 . [Q6JQN1-1 ]
ENST00000455480 ; ENSP00000389813 ; ENSG00000111271 . [Q6JQN1-5 ]
GeneIDi 80724.
KEGGi hsa:80724.
UCSCi uc001tso.4. human. [Q6JQN1-4 ]
uc001tsp.3. human. [Q6JQN1-2 ]
uc001tsq.3. human. [Q6JQN1-1 ]
uc009zvx.3. human.

Organism-specific databases

CTDi 80724.
GeneCardsi GC12P112123.
HGNCi HGNC:21597. ACAD10.
MIMi 611181. gene.
neXtProti NX_Q6JQN1.
PharmGKBi PA134976754.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG1011.
GeneTreei ENSGT00760000119007.
HOGENOMi HOG000131666.
HOVERGENi HBG057142.
InParanoidi Q6JQN1.
KOi K11729.
OMAi CMRLIGF.
OrthoDBi EOG7JDQWS.
PhylomeDBi Q6JQN1.
TreeFami TF333953.

Miscellaneous databases

GenomeRNAii 80724.
NextBioi 71031.
PROi Q6JQN1.
SOURCEi Search...

Gene expression databases

Bgeei Q6JQN1.
CleanExi HS_ACAD10.
ExpressionAtlasi Q6JQN1. baseline.
Genevestigatori Q6JQN1.

Family and domain databases

Gene3Di 1.10.150.240. 1 hit.
1.10.540.10. 1 hit.
2.40.110.10. 1 hit.
3.40.50.1000. 1 hit.
InterProi IPR006091. Acyl-CoA_Oxase/DH_cen-dom.
IPR009075. AcylCo_DH/oxidase_C.
IPR013786. AcylCoA_DH/ox_N.
IPR009100. AcylCoA_DH/oxidase_NM_dom.
IPR002575. Aminoglycoside_PTrfase.
IPR023214. HAD-like_dom.
IPR006439. HAD-SF_hydro_IA.
IPR011945. HAD-SF_ppase_IA/epoxid_hydro_N.
IPR011009. Kinase-like_dom.
IPR023198. PGP_dom2.
[Graphical view ]
Pfami PF00441. Acyl-CoA_dh_1. 1 hit.
PF02770. Acyl-CoA_dh_M. 1 hit.
PF02771. Acyl-CoA_dh_N. 1 hit.
PF01636. APH. 1 hit.
PF13419. HAD_2. 1 hit.
[Graphical view ]
PRINTSi PR00413. HADHALOGNASE.
SUPFAMi SSF47203. SSF47203. 1 hit.
SSF56112. SSF56112. 1 hit.
SSF56645. SSF56645. 1 hit.
SSF56784. SSF56784. 1 hit.
TIGRFAMsi TIGR02247. HAD-1A3-hyp. 1 hit.
TIGR01509. HAD-SF-IA-v3. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of a human cDNA ACAD10 mapped to chromosome 12q24.1."
    Ye X., Ji C., Zhou C., Zeng L., Gu S., Ying K., Xie Y., Mao Y.
    Mol. Biol. Rep. 31:191-195(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    Tissue: Fetal brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Tissue: Brain and Testis.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
    Tissue: Bone marrow.
  4. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4).
    Tissue: Skin.
  7. "Identification and characterization of new long chain acyl-CoA dehydrogenases."
    He M., Pei Z., Mohsen A.W., Watkins P., Murdoch G., Van Veldhoven P.P., Ensenauer R., Vockley J.
    Mol. Genet. Metab. 102:418-429(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY.

Entry informationi

Entry nameiACD10_HUMAN
AccessioniPrimary (citable) accession number: Q6JQN1
Secondary accession number(s): G3XAJ0
, Q8N828, Q8NAP2, Q96BX5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: July 5, 2004
Last modified: October 29, 2014
This is version 100 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3