Q6ISU1 (PTCRA_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 76.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Pre T-cell antigen receptor alpha Short name=pT-alpha Short name=pTa Alternative name(s): pT-alpha-TCR | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 281 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | The pre-T-cell receptor complex (composed of PTCRA, TCRB and the CD3 complex) regulates early T-cell development By similarity. |
| Subunit structure | Heterodimer with TCRB; disulfide linked. This heterodimer assembles with CD3 proteins into a signaling-competent pre-T-cell receptor complex. Interacts with RHBDD1. Ref.6 Ref.7 Ref.8 |
| Subcellular location | Membrane; Single-pass type I membrane protein Potential. |
| Tissue specificity | Expressed in immature but not mature T-cells. Also found in CD34+ cells from peripheral blood, CD34+ precursors from umbilical cord blood and adult bone marrow. Ref.1 Ref.6 |
| Developmental stage | Expressed in fetal life in CD34+ progenitors present in the liver at 18 weeks of gestation but is absent in CD34+ precursors from fetal bone marrow at any developmental stage up to 22 weeks. Ref.6 |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal Transmembrane Transmembrane helix |
| Molecular function | Receptor |
| PTM | Disulfide bond Glycoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | negative regulation of thymocyte apoptotic process Inferred from electronic annotation. Source: Compara |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6ISU1-1) Also known as: pTalpha-1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6ISU1-2) Also known as: pTalpha-2; The sequence of this isoform differs from the canonical sequence as follows: 20-126: Missing. | ||||||
| Isoform 3 (identifier: Q6ISU1-3) The sequence of this isoform differs from the canonical sequence as follows: 21-59: VGGTPFPSLAPPIMLLVDGKQQMVVVCLVLDVAPPGLDS → PVSFPSSPEAATTG |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||
Molecule processing | ||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 23 | 23 | Potential | |||||||||||||||||||
| Chain | 24 – 281 | 258 | Pre T-cell antigen receptor alpha | PRO_0000319108 | ||||||||||||||||||
Regions | ||||||||||||||||||||||
| Topological domain | 24 – 146 | 123 | Extracellular Potential | |||||||||||||||||||
| Transmembrane | 147 – 167 | 21 | Helical; Potential | |||||||||||||||||||
| Topological domain | 168 – 281 | 114 | Cytoplasmic Potential | |||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||
| Glycosylation | 67 | 1 | N-linked (GlcNAc...) Ref.8 | |||||||||||||||||||
| Disulfide bond | 47 ↔ 107 | Ref.8 | ||||||||||||||||||||
| Disulfide bond | 135 | Interchain (with TCRB) Probable | ||||||||||||||||||||
Natural variations | ||||||||||||||||||||||
| Alternative sequence | 20 – 126 | 107 | Missing in isoform 2. | VSP_031445 | ||||||||||||||||||
| Alternative sequence | 21 – 59 | 39 | VGGTP…PGLDS → PVSFPSSPEAATTG in isoform 3. | VSP_031446 | ||||||||||||||||||
| Natural variant | 106 | 1 | V → I. Ref.5 Corresponds to variant rs9471966 [ dbSNP | Ensembl ]. | VAR_038957 | ||||||||||||||||||
| Natural variant | 183 | 1 | A → T. Corresponds to variant rs36111725 [ dbSNP | Ensembl ]. | VAR_038958 | ||||||||||||||||||
Experimental info | ||||||||||||||||||||||
| Sequence conflict | 256 | 1 | A → R in AAB06194. Ref.1 | |||||||||||||||||||
| Sequence conflict | 256 | 1 | A → R in AAC83346. Ref.2 | |||||||||||||||||||
| Sequence conflict | 256 | 1 | A → R in AAF89556. Ref.3 | |||||||||||||||||||
| Sequence conflict | 256 | 1 | A → R in AAB18373. Ref.6 | |||||||||||||||||||
| Sequence conflict | 269 | 1 | A → R in AAB06194. Ref.1 | |||||||||||||||||||
Secondary structure | ||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||
| Beta strand | 33 – 52 | 20 | ||||||||||||||||||||
| Beta strand | 62 – 64 | 3 | ||||||||||||||||||||
| Beta strand | 66 – 68 | 3 | ||||||||||||||||||||
| Beta strand | 79 – 81 | 3 | ||||||||||||||||||||
| Turn | 82 – 84 | 3 | ||||||||||||||||||||
| Beta strand | 85 – 95 | 11 | ||||||||||||||||||||
| Helix | 96 – 100 | 5 | ||||||||||||||||||||
| Beta strand | 104 – 109 | 6 | ||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and comparative analysis of the human pre-T-cell receptor alpha-chain gene." Del Porto P., Bruno L., Mattei M.-G., von Boehmer H., Saint-Ruf C. Proc. Natl. Acad. Sci. U.S.A. 92:12105-12109(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. Tissue: Thymus. |
| [2] | "Genomic structure of the human pre-T cell receptor alpha chain and expression of two mRNA isoforms." Saint-Ruf C., Lechner O., Feinberg J., von Boehmer H. Eur. J. Immunol. 28:3824-3831(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1 AND 2). Tissue: Lymphoblast. |
| [3] | "Alternatively spliced human pre-T alpha chain, mRNA." Ramiro A.R., Toribio M.L. Submitted (OCT-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3). |
| [4] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ILE-106. |
| [6] | "Regulation of pre-T cell receptor (pT alpha-TCR beta) gene expression during human thymic development." Ramiro A.R., Trigueros C., Marquez C., San Millan J.L., Toribio M.L. J. Exp. Med. 184:519-530(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 13-281 (ISOFORM 1), SUBUNIT, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE. Tissue: Thymus. |
| [7] | "Ubiquitin-Dependent Intramembrane Rhomboid Protease Promotes ERAD of Membrane Proteins." Fleig L., Bergbold N., Sahasrabudhe P., Geiger B., Kaltak L., Lemberg M.K. Mol. Cell 47:558-569(2012) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH RHBDD1. |
| [8] | "The structural basis for autonomous dimerization of the pre-T-cell antigen receptor." Pang S.S., Berry R., Chen Z., Kjer-Nielsen L., Perugini M.A., King G.F., Wang C., Chew S.H., La Gruta N.L., Williams N.K., Beddoe T., Tiganis T., Cowieson N.P., Godfrey D.I., Purcell A.W., Wilce M.C., McCluskey J., Rossjohn J. Nature 467:844-848(2010) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS) OF 17-135, SUBUNIT, DISULFIDE BOND, GLYCOSYLATION AT ASN-67. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U36759 mRNA. Translation: AAB06194.1. AF084941 Genomic DNA. Translation: AAC83346.1. AF101436 mRNA. Translation: AAF21890.1. AF165312 mRNA. Translation: AAF89556.1. AL035587 Genomic DNA. Translation: CAI21484.2. BC069336 mRNA. Translation: AAH69336.1. BC100771 mRNA. Translation: AAI00772.1. BC100772 mRNA. Translation: AAI00773.1. BC100773 mRNA. Translation: AAI00774.1. BC100774 mRNA. Translation: AAI00775.1. BC153829 mRNA. Translation: AAI53830.1. U38996 mRNA. Translation: AAB18373.1. | ||||||||||||
| IPI | IPI00514715. IPI00884912. IPI00885032. | ||||||||||||
| RefSeq | NP_001230097.1. NM_001243168.1. NP_001230098.1. NM_001243169.1. NP_001230099.1. NM_001243170.1. NP_612153.2. NM_138296.2. | ||||||||||||
| UniGene | Hs.169002. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q6ISU1. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| MINT | MINT-7219046. | ||||||||||||
| STRING | 9606.ENSP00000304447. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 74736631. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q6ISU1. | ||||||||||||
| PRIDE | Q6ISU1. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000304672; ENSP00000304447; ENSG00000171611. ENST00000441198; ENSP00000409550; ENSG00000171611. ENST00000446507; ENSP00000392288; ENSG00000171611. | ||||||||||||
| GeneID | 171558. | ||||||||||||
| KEGG | hsa:171558. | ||||||||||||
| UCSC | uc003osx.3. human. uc010jxy.3. human. uc010jxz.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 171558. | ||||||||||||
| GeneCards | GC06P042883. | ||||||||||||
| HGNC | HGNC:21290. PTCRA. | ||||||||||||
| MIM | 606817. gene. | ||||||||||||
| neXtProt | NX_Q6ISU1. | ||||||||||||
| PharmGKB | PA134993184. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG25752. | ||||||||||||
| HOGENOM | HOG000115761. | ||||||||||||
| HOVERGEN | HBG061856. | ||||||||||||
| InParanoid | Q6ISU1. | ||||||||||||
| KO | K06056. | ||||||||||||
| OMA | SPVWEEG. | ||||||||||||
| OrthoDB | EOG4WSWC1. | ||||||||||||
| PhylomeDB | Q6ISU1. | ||||||||||||
Gene expression databases | |||||||||||||
| Bgee | Q6ISU1. | ||||||||||||
| CleanEx | HS_PTCRA. | ||||||||||||
| Genevestigator | Q6ISU1. | ||||||||||||
Family and domain databases | |||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | Q6ISU1. | ||||||||||||
| GenomeRNAi | 171558. | ||||||||||||
| NextBio | 89289. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | PTCRA_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6ISU1 Secondary accession number(s): Q5TFZ7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |

Clusters with
