Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6ISU1

- PTCRA_HUMAN

UniProt

Q6ISU1 - PTCRA_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Pre T-cell antigen receptor alpha

Gene

PTCRA

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli

Functioni

The pre-T-cell receptor complex (composed of PTCRA, TCRB and the CD3 complex) regulates early T-cell development.By similarity

GO - Biological processi

  1. negative regulation of thymocyte apoptotic process Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Names & Taxonomyi

Protein namesi
Recommended name:
Pre T-cell antigen receptor alpha
Short name:
pT-alpha
Short name:
pTa
Alternative name(s):
pT-alpha-TCR
Gene namesi
Name:PTCRA
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 6

Organism-specific databases

HGNCiHGNC:21290. PTCRA.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini24 – 146123ExtracellularSequence AnalysisAdd
BLAST
Transmembranei147 – 16721HelicalSequence AnalysisAdd
BLAST
Topological domaini168 – 281114CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134993184.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2323Sequence AnalysisAdd
BLAST
Chaini24 – 281258Pre T-cell antigen receptor alphaPRO_0000319108Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi47 ↔ 1071 Publication
Glycosylationi67 – 671N-linked (GlcNAc...)1 Publication
Disulfide bondi135 – 135Interchain (with TCRB)1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ6ISU1.
PRIDEiQ6ISU1.

Expressioni

Tissue specificityi

Expressed in immature but not mature T-cells. Also found in CD34+ cells from peripheral blood, CD34+ precursors from umbilical cord blood and adult bone marrow.2 Publications

Developmental stagei

Expressed in fetal life in CD34+ progenitors present in the liver at 18 weeks of gestation but is absent in CD34+ precursors from fetal bone marrow at any developmental stage up to 22 weeks.1 Publication

Gene expression databases

BgeeiQ6ISU1.
CleanExiHS_PTCRA.
GenevestigatoriQ6ISU1.

Interactioni

Subunit structurei

Heterodimer with TCRB; disulfide linked. This heterodimer assembles with CD3 proteins into a signaling-competent pre-T-cell receptor complex. Interacts with RHBDD1.3 Publications

Protein-protein interaction databases

BioGridi128144. 7 interactions.
IntActiQ6ISU1. 1 interaction.
MINTiMINT-7219046.
STRINGi9606.ENSP00000304447.

Structurei

Secondary structure

1
281
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi33 – 5220Combined sources
Beta strandi62 – 643Combined sources
Beta strandi66 – 683Combined sources
Beta strandi79 – 813Combined sources
Turni82 – 843Combined sources
Beta strandi85 – 9511Combined sources
Helixi96 – 1005Combined sources
Beta strandi104 – 1096Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3OF6X-ray2.80D/E/F17-135[»]
ProteinModelPortaliQ6ISU1.
SMRiQ6ISU1. Positions 23-126.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ6ISU1.

Family & Domainsi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG25752.
GeneTreeiENSGT00390000007712.
HOGENOMiHOG000115761.
HOVERGENiHBG061856.
InParanoidiQ6ISU1.
KOiK06056.
OMAiSPVWEEG.
OrthoDBiEOG75B864.
PhylomeDBiQ6ISU1.
TreeFamiTF337868.

Family and domain databases

InterProiIPR027834. PTCRA.
[Graphical view]
PfamiPF15028. PTCRA. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6ISU1-1) [UniParc]FASTAAdd to Basket

Also known as: pTalpha-1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGTWLLLLL ALGCPALPTG VGGTPFPSLA PPIMLLVDGK QQMVVVCLVL
60 70 80 90 100
DVAPPGLDSP IWFSAGNGSA LDAFTYGPSP ATDGTWTNLA HLSLPSEELA
110 120 130 140 150
SWEPLVCHTG PGAEGHSRST QPMHLSGEAS TARTCPQEPL RGTPGGALWL
160 170 180 190 200
GVLRLLLFKL LLFDLLLTCS CLCDPAGPLP SPATTTRLRA LGSHRLHPAT
210 220 230 240 250
ETGGREATSS PRPQPRDRRW GDTPPGRKPG SPVWGEGSYL SSYPTCPAQA
260 270 280
WCSRSALRAP SSSLGAFFAG DLPPPLQAGA A
Length:281
Mass (Da):29,266
Last modified:July 5, 2004 - v1
Checksum:iA49B86A151619B9F
GO
Isoform 2 (identifier: Q6ISU1-2) [UniParc]FASTAAdd to Basket

Also known as: pTalpha-2

The sequence of this isoform differs from the canonical sequence as follows:
     20-126: Missing.

Show »
Length:174
Mass (Da):18,222
Checksum:iA7EAEAD3884692A3
GO
Isoform 3 (identifier: Q6ISU1-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     21-59: VGGTPFPSLAPPIMLLVDGKQQMVVVCLVLDVAPPGLDS → PVSFPSSPEAATTG

Show »
Length:256
Mass (Da):26,638
Checksum:i815805A8311B0B3B
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti256 – 2561A → R in AAB06194. (PubMed:8618853)Curated
Sequence conflicti256 – 2561A → R in AAC83346. (PubMed:9842925)Curated
Sequence conflicti256 – 2561A → R in AAF89556. 1 PublicationCurated
Sequence conflicti256 – 2561A → R in AAB18373. (PubMed:8760805)Curated
Sequence conflicti269 – 2691A → R in AAB06194. (PubMed:8618853)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti106 – 1061V → I.1 Publication
Corresponds to variant rs9471966 [ dbSNP | Ensembl ].
VAR_038957
Natural varianti183 – 1831A → T.
Corresponds to variant rs36111725 [ dbSNP | Ensembl ].
VAR_038958

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei20 – 126107Missing in isoform 2. 1 PublicationVSP_031445Add
BLAST
Alternative sequencei21 – 5939VGGTP…PGLDS → PVSFPSSPEAATTG in isoform 3. 1 PublicationVSP_031446Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U36759 mRNA. Translation: AAB06194.1.
AF084941 Genomic DNA. Translation: AAC83346.1.
AF101436 mRNA. Translation: AAF21890.1.
AF165312 mRNA. Translation: AAF89556.1.
AL035587 Genomic DNA. Translation: CAI21484.2.
BC069336 mRNA. Translation: AAH69336.1.
BC100771 mRNA. Translation: AAI00772.1.
BC100772 mRNA. Translation: AAI00773.1.
BC100773 mRNA. Translation: AAI00774.1.
BC100774 mRNA. Translation: AAI00775.1.
BC153829 mRNA. Translation: AAI53830.1.
U38996 mRNA. Translation: AAB18373.1.
CCDSiCCDS4874.1. [Q6ISU1-1]
CCDS59019.1. [Q6ISU1-3]
CCDS59020.1. [Q6ISU1-2]
RefSeqiNP_001230097.1. NM_001243168.1.
NP_001230098.1. NM_001243169.1. [Q6ISU1-3]
NP_001230099.1. NM_001243170.1. [Q6ISU1-2]
NP_612153.2. NM_138296.2. [Q6ISU1-1]
UniGeneiHs.169002.

Genome annotation databases

EnsembliENST00000304672; ENSP00000304447; ENSG00000171611. [Q6ISU1-1]
ENST00000441198; ENSP00000409550; ENSG00000171611. [Q6ISU1-3]
ENST00000446507; ENSP00000392288; ENSG00000171611. [Q6ISU1-2]
GeneIDi171558.
KEGGihsa:171558.
UCSCiuc003osx.3. human. [Q6ISU1-1]
uc010jxy.3. human. [Q6ISU1-3]
uc010jxz.3. human. [Q6ISU1-2]

Polymorphism databases

DMDMi74736631.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U36759 mRNA. Translation: AAB06194.1 .
AF084941 Genomic DNA. Translation: AAC83346.1 .
AF101436 mRNA. Translation: AAF21890.1 .
AF165312 mRNA. Translation: AAF89556.1 .
AL035587 Genomic DNA. Translation: CAI21484.2 .
BC069336 mRNA. Translation: AAH69336.1 .
BC100771 mRNA. Translation: AAI00772.1 .
BC100772 mRNA. Translation: AAI00773.1 .
BC100773 mRNA. Translation: AAI00774.1 .
BC100774 mRNA. Translation: AAI00775.1 .
BC153829 mRNA. Translation: AAI53830.1 .
U38996 mRNA. Translation: AAB18373.1 .
CCDSi CCDS4874.1. [Q6ISU1-1 ]
CCDS59019.1. [Q6ISU1-3 ]
CCDS59020.1. [Q6ISU1-2 ]
RefSeqi NP_001230097.1. NM_001243168.1.
NP_001230098.1. NM_001243169.1. [Q6ISU1-3 ]
NP_001230099.1. NM_001243170.1. [Q6ISU1-2 ]
NP_612153.2. NM_138296.2. [Q6ISU1-1 ]
UniGenei Hs.169002.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
3OF6 X-ray 2.80 D/E/F 17-135 [» ]
ProteinModelPortali Q6ISU1.
SMRi Q6ISU1. Positions 23-126.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 128144. 7 interactions.
IntActi Q6ISU1. 1 interaction.
MINTi MINT-7219046.
STRINGi 9606.ENSP00000304447.

Polymorphism databases

DMDMi 74736631.

Proteomic databases

PaxDbi Q6ISU1.
PRIDEi Q6ISU1.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000304672 ; ENSP00000304447 ; ENSG00000171611 . [Q6ISU1-1 ]
ENST00000441198 ; ENSP00000409550 ; ENSG00000171611 . [Q6ISU1-3 ]
ENST00000446507 ; ENSP00000392288 ; ENSG00000171611 . [Q6ISU1-2 ]
GeneIDi 171558.
KEGGi hsa:171558.
UCSCi uc003osx.3. human. [Q6ISU1-1 ]
uc010jxy.3. human. [Q6ISU1-3 ]
uc010jxz.3. human. [Q6ISU1-2 ]

Organism-specific databases

CTDi 171558.
GeneCardsi GC06P042883.
HGNCi HGNC:21290. PTCRA.
MIMi 606817. gene.
neXtProti NX_Q6ISU1.
PharmGKBi PA134993184.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG25752.
GeneTreei ENSGT00390000007712.
HOGENOMi HOG000115761.
HOVERGENi HBG061856.
InParanoidi Q6ISU1.
KOi K06056.
OMAi SPVWEEG.
OrthoDBi EOG75B864.
PhylomeDBi Q6ISU1.
TreeFami TF337868.

Miscellaneous databases

EvolutionaryTracei Q6ISU1.
GenomeRNAii 171558.
NextBioi 89289.
PROi Q6ISU1.
SOURCEi Search...

Gene expression databases

Bgeei Q6ISU1.
CleanExi HS_PTCRA.
Genevestigatori Q6ISU1.

Family and domain databases

InterProi IPR027834. PTCRA.
[Graphical view ]
Pfami PF15028. PTCRA. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and comparative analysis of the human pre-T-cell receptor alpha-chain gene."
    Del Porto P., Bruno L., Mattei M.-G., von Boehmer H., Saint-Ruf C.
    Proc. Natl. Acad. Sci. U.S.A. 92:12105-12109(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    Tissue: Thymus.
  2. "Genomic structure of the human pre-T cell receptor alpha chain and expression of two mRNA isoforms."
    Saint-Ruf C., Lechner O., Feinberg J., von Boehmer H.
    Eur. J. Immunol. 28:3824-3831(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1 AND 2).
    Tissue: Lymphoblast.
  3. "Alternatively spliced human pre-T alpha chain, mRNA."
    Ramiro A.R., Toribio M.L.
    Submitted (OCT-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3).
  4. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ILE-106.
  6. "Regulation of pre-T cell receptor (pT alpha-TCR beta) gene expression during human thymic development."
    Ramiro A.R., Trigueros C., Marquez C., San Millan J.L., Toribio M.L.
    J. Exp. Med. 184:519-530(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 13-281 (ISOFORM 1), SUBUNIT, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    Tissue: Thymus.
  7. "Ubiquitin-dependent intramembrane rhomboid protease promotes ERAD of membrane proteins."
    Fleig L., Bergbold N., Sahasrabudhe P., Geiger B., Kaltak L., Lemberg M.K.
    Mol. Cell 47:558-569(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH RHBDD1.
  8. Cited for: X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS) OF 17-135, SUBUNIT, DISULFIDE BOND, GLYCOSYLATION AT ASN-67.

Entry informationi

Entry nameiPTCRA_HUMAN
AccessioniPrimary (citable) accession number: Q6ISU1
Secondary accession number(s): Q5TFZ7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: July 5, 2004
Last modified: November 26, 2014
This is version 88 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references

External Data

Dasty 3