Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q6ISU1 (PTCRA_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 82. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Pre T-cell antigen receptor alpha

Short name=pT-alpha
Short name=pTa
Alternative name(s):
pT-alpha-TCR
Gene names
Name:PTCRA
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length281 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

The pre-T-cell receptor complex (composed of PTCRA, TCRB and the CD3 complex) regulates early T-cell development By similarity.

Subunit structure

Heterodimer with TCRB; disulfide linked. This heterodimer assembles with CD3 proteins into a signaling-competent pre-T-cell receptor complex. Interacts with RHBDD1. Ref.6 Ref.7 Ref.8

Subcellular location

Membrane; Single-pass type I membrane protein Potential.

Tissue specificity

Expressed in immature but not mature T-cells. Also found in CD34+ cells from peripheral blood, CD34+ precursors from umbilical cord blood and adult bone marrow. Ref.1 Ref.6

Developmental stage

Expressed in fetal life in CD34+ progenitors present in the liver at 18 weeks of gestation but is absent in CD34+ precursors from fetal bone marrow at any developmental stage up to 22 weeks. Ref.6

Ontologies

Keywords
   Cellular componentMembrane
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainSignal
Transmembrane
Transmembrane helix
   Molecular functionReceptor
   PTMDisulfide bond
Glycoprotein
   Technical term3D-structure
Complete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processnegative regulation of thymocyte apoptotic process

Inferred from electronic annotation. Source: Ensembl

   Cellular_componentintegral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q6ISU1-1)

Also known as: pTalpha-1;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q6ISU1-2)

Also known as: pTalpha-2;

The sequence of this isoform differs from the canonical sequence as follows:
     20-126: Missing.
Isoform 3 (identifier: Q6ISU1-3)

The sequence of this isoform differs from the canonical sequence as follows:
     21-59: VGGTPFPSLAPPIMLLVDGKQQMVVVCLVLDVAPPGLDS → PVSFPSSPEAATTG

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2323 Potential
Chain24 – 281258Pre T-cell antigen receptor alpha
PRO_0000319108

Regions

Topological domain24 – 146123Extracellular Potential
Transmembrane147 – 16721Helical; Potential
Topological domain168 – 281114Cytoplasmic Potential

Amino acid modifications

Glycosylation671N-linked (GlcNAc...) Ref.8
Disulfide bond47 ↔ 107 Ref.8
Disulfide bond135Interchain (with TCRB) Probable

Natural variations

Alternative sequence20 – 126107Missing in isoform 2.
VSP_031445
Alternative sequence21 – 5939VGGTP…PGLDS → PVSFPSSPEAATTG in isoform 3.
VSP_031446
Natural variant1061V → I. Ref.5
Corresponds to variant rs9471966 [ dbSNP | Ensembl ].
VAR_038957
Natural variant1831A → T.
Corresponds to variant rs36111725 [ dbSNP | Ensembl ].
VAR_038958

Experimental info

Sequence conflict2561A → R in AAB06194. Ref.1
Sequence conflict2561A → R in AAC83346. Ref.2
Sequence conflict2561A → R in AAF89556. Ref.3
Sequence conflict2561A → R in AAB18373. Ref.6
Sequence conflict2691A → R in AAB06194. Ref.1

Secondary structure

.............. 281
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (pTalpha-1) [UniParc].

Last modified July 5, 2004. Version 1.
Checksum: A49B86A151619B9F

FASTA28129,266
        10         20         30         40         50         60 
MAGTWLLLLL ALGCPALPTG VGGTPFPSLA PPIMLLVDGK QQMVVVCLVL DVAPPGLDSP 

        70         80         90        100        110        120 
IWFSAGNGSA LDAFTYGPSP ATDGTWTNLA HLSLPSEELA SWEPLVCHTG PGAEGHSRST 

       130        140        150        160        170        180 
QPMHLSGEAS TARTCPQEPL RGTPGGALWL GVLRLLLFKL LLFDLLLTCS CLCDPAGPLP 

       190        200        210        220        230        240 
SPATTTRLRA LGSHRLHPAT ETGGREATSS PRPQPRDRRW GDTPPGRKPG SPVWGEGSYL 

       250        260        270        280 
SSYPTCPAQA WCSRSALRAP SSSLGAFFAG DLPPPLQAGA A 

« Hide

Isoform 2 (pTalpha-2) [UniParc].

Checksum: A7EAEAD3884692A3
Show »

FASTA17418,222
Isoform 3 [UniParc].

Checksum: 815805A8311B0B3B
Show »

FASTA25626,638

References

« Hide 'large scale' references
[1]"Cloning and comparative analysis of the human pre-T-cell receptor alpha-chain gene."
Del Porto P., Bruno L., Mattei M.-G., von Boehmer H., Saint-Ruf C.
Proc. Natl. Acad. Sci. U.S.A. 92:12105-12109(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
Tissue: Thymus.
[2]"Genomic structure of the human pre-T cell receptor alpha chain and expression of two mRNA isoforms."
Saint-Ruf C., Lechner O., Feinberg J., von Boehmer H.
Eur. J. Immunol. 28:3824-3831(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1 AND 2).
Tissue: Lymphoblast.
[3]"Alternatively spliced human pre-T alpha chain, mRNA."
Ramiro A.R., Toribio M.L.
Submitted (OCT-1998) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3).
[4]"The DNA sequence and analysis of human chromosome 6."
Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. expand/collapse author list , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ILE-106.
[6]"Regulation of pre-T cell receptor (pT alpha-TCR beta) gene expression during human thymic development."
Ramiro A.R., Trigueros C., Marquez C., San Millan J.L., Toribio M.L.
J. Exp. Med. 184:519-530(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 13-281 (ISOFORM 1), SUBUNIT, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
Tissue: Thymus.
[7]"Ubiquitin-dependent intramembrane rhomboid protease promotes ERAD of membrane proteins."
Fleig L., Bergbold N., Sahasrabudhe P., Geiger B., Kaltak L., Lemberg M.K.
Mol. Cell 47:558-569(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH RHBDD1.
[8]"The structural basis for autonomous dimerization of the pre-T-cell antigen receptor."
Pang S.S., Berry R., Chen Z., Kjer-Nielsen L., Perugini M.A., King G.F., Wang C., Chew S.H., La Gruta N.L., Williams N.K., Beddoe T., Tiganis T., Cowieson N.P., Godfrey D.I., Purcell A.W., Wilce M.C., McCluskey J., Rossjohn J.
Nature 467:844-848(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS) OF 17-135, SUBUNIT, DISULFIDE BOND, GLYCOSYLATION AT ASN-67.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U36759 mRNA. Translation: AAB06194.1.
AF084941 Genomic DNA. Translation: AAC83346.1.
AF101436 mRNA. Translation: AAF21890.1.
AF165312 mRNA. Translation: AAF89556.1.
AL035587 Genomic DNA. Translation: CAI21484.2.
BC069336 mRNA. Translation: AAH69336.1.
BC100771 mRNA. Translation: AAI00772.1.
BC100772 mRNA. Translation: AAI00773.1.
BC100773 mRNA. Translation: AAI00774.1.
BC100774 mRNA. Translation: AAI00775.1.
BC153829 mRNA. Translation: AAI53830.1.
U38996 mRNA. Translation: AAB18373.1.
RefSeqNP_001230097.1. NM_001243168.1.
NP_001230098.1. NM_001243169.1.
NP_001230099.1. NM_001243170.1.
NP_612153.2. NM_138296.2.
UniGeneHs.169002.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
3OF6X-ray2.80D/E/F17-135[»]
ProteinModelPortalQ6ISU1.
SMRQ6ISU1. Positions 23-126.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid128144. 4 interactions.
IntActQ6ISU1. 1 interaction.
MINTMINT-7219046.
STRING9606.ENSP00000304447.

Polymorphism databases

DMDM74736631.

Proteomic databases

PaxDbQ6ISU1.
PRIDEQ6ISU1.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000304672; ENSP00000304447; ENSG00000171611. [Q6ISU1-1]
ENST00000441198; ENSP00000409550; ENSG00000171611. [Q6ISU1-3]
ENST00000446507; ENSP00000392288; ENSG00000171611. [Q6ISU1-2]
GeneID171558.
KEGGhsa:171558.
UCSCuc003osx.3. human. [Q6ISU1-1]
uc010jxy.3. human. [Q6ISU1-3]
uc010jxz.3. human. [Q6ISU1-2]

Organism-specific databases

CTD171558.
GeneCardsGC06P042883.
HGNCHGNC:21290. PTCRA.
MIM606817. gene.
neXtProtNX_Q6ISU1.
PharmGKBPA134993184.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG25752.
HOGENOMHOG000115761.
HOVERGENHBG061856.
InParanoidQ6ISU1.
KOK06056.
OMASPVWEEG.
OrthoDBEOG75B864.
PhylomeDBQ6ISU1.
TreeFamTF337868.

Gene expression databases

BgeeQ6ISU1.
CleanExHS_PTCRA.
GenevestigatorQ6ISU1.

Family and domain databases

InterProIPR027834. PTCRA.
[Graphical view]
PfamPF15028. PTCRA. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceQ6ISU1.
GenomeRNAi171558.
NextBio89289.
PROQ6ISU1.
SOURCESearch...

Entry information

Entry namePTCRA_HUMAN
AccessionPrimary (citable) accession number: Q6ISU1
Secondary accession number(s): Q5TFZ7
Entry history
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: July 5, 2004
Last modified: March 19, 2014
This is version 82 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 6

Human chromosome 6: entries, gene names and cross-references to MIM