Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6ISU1

- PTCRA_HUMAN

UniProt

Q6ISU1 - PTCRA_HUMAN

Protein

Pre T-cell antigen receptor alpha

Gene

PTCRA

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 86 (01 Oct 2014)
      Sequence version 1 (05 Jul 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    The pre-T-cell receptor complex (composed of PTCRA, TCRB and the CD3 complex) regulates early T-cell development.By similarity

    GO - Molecular functioni

    1. protein binding Source: UniProtKB

    GO - Biological processi

    1. negative regulation of thymocyte apoptotic process Source: Ensembl

    Keywords - Molecular functioni

    Receptor

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Pre T-cell antigen receptor alpha
    Short name:
    pT-alpha
    Short name:
    pTa
    Alternative name(s):
    pT-alpha-TCR
    Gene namesi
    Name:PTCRA
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 6

    Organism-specific databases

    HGNCiHGNC:21290. PTCRA.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134993184.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2323Sequence AnalysisAdd
    BLAST
    Chaini24 – 281258Pre T-cell antigen receptor alphaPRO_0000319108Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi47 ↔ 1071 Publication
    Glycosylationi67 – 671N-linked (GlcNAc...)1 Publication
    Disulfide bondi135 – 135Interchain (with TCRB)1 Publication

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ6ISU1.
    PRIDEiQ6ISU1.

    Expressioni

    Tissue specificityi

    Expressed in immature but not mature T-cells. Also found in CD34+ cells from peripheral blood, CD34+ precursors from umbilical cord blood and adult bone marrow.2 Publications

    Developmental stagei

    Expressed in fetal life in CD34+ progenitors present in the liver at 18 weeks of gestation but is absent in CD34+ precursors from fetal bone marrow at any developmental stage up to 22 weeks.1 Publication

    Gene expression databases

    BgeeiQ6ISU1.
    CleanExiHS_PTCRA.
    GenevestigatoriQ6ISU1.

    Interactioni

    Subunit structurei

    Heterodimer with TCRB; disulfide linked. This heterodimer assembles with CD3 proteins into a signaling-competent pre-T-cell receptor complex. Interacts with RHBDD1.3 Publications

    Protein-protein interaction databases

    BioGridi128144. 4 interactions.
    IntActiQ6ISU1. 1 interaction.
    MINTiMINT-7219046.
    STRINGi9606.ENSP00000304447.

    Structurei

    Secondary structure

    1
    281
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi33 – 5220
    Beta strandi62 – 643
    Beta strandi66 – 683
    Beta strandi79 – 813
    Turni82 – 843
    Beta strandi85 – 9511
    Helixi96 – 1005
    Beta strandi104 – 1096

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    3OF6X-ray2.80D/E/F17-135[»]
    ProteinModelPortaliQ6ISU1.
    SMRiQ6ISU1. Positions 23-126.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ6ISU1.

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini24 – 146123ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini168 – 281114CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei147 – 16721HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Keywords - Domaini

    Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG25752.
    HOGENOMiHOG000115761.
    HOVERGENiHBG061856.
    InParanoidiQ6ISU1.
    KOiK06056.
    OMAiSPVWEEG.
    OrthoDBiEOG75B864.
    PhylomeDBiQ6ISU1.
    TreeFamiTF337868.

    Family and domain databases

    InterProiIPR027834. PTCRA.
    [Graphical view]
    PfamiPF15028. PTCRA. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6ISU1-1) [UniParc]FASTAAdd to Basket

    Also known as: pTalpha-1

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAGTWLLLLL ALGCPALPTG VGGTPFPSLA PPIMLLVDGK QQMVVVCLVL    50
    DVAPPGLDSP IWFSAGNGSA LDAFTYGPSP ATDGTWTNLA HLSLPSEELA 100
    SWEPLVCHTG PGAEGHSRST QPMHLSGEAS TARTCPQEPL RGTPGGALWL 150
    GVLRLLLFKL LLFDLLLTCS CLCDPAGPLP SPATTTRLRA LGSHRLHPAT 200
    ETGGREATSS PRPQPRDRRW GDTPPGRKPG SPVWGEGSYL SSYPTCPAQA 250
    WCSRSALRAP SSSLGAFFAG DLPPPLQAGA A 281
    Length:281
    Mass (Da):29,266
    Last modified:July 5, 2004 - v1
    Checksum:iA49B86A151619B9F
    GO
    Isoform 2 (identifier: Q6ISU1-2) [UniParc]FASTAAdd to Basket

    Also known as: pTalpha-2

    The sequence of this isoform differs from the canonical sequence as follows:
         20-126: Missing.

    Show »
    Length:174
    Mass (Da):18,222
    Checksum:iA7EAEAD3884692A3
    GO
    Isoform 3 (identifier: Q6ISU1-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         21-59: VGGTPFPSLAPPIMLLVDGKQQMVVVCLVLDVAPPGLDS → PVSFPSSPEAATTG

    Show »
    Length:256
    Mass (Da):26,638
    Checksum:i815805A8311B0B3B
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti256 – 2561A → R in AAB06194. (PubMed:8618853)Curated
    Sequence conflicti256 – 2561A → R in AAC83346. (PubMed:9842925)Curated
    Sequence conflicti256 – 2561A → R in AAF89556. 1 PublicationCurated
    Sequence conflicti256 – 2561A → R in AAB18373. (PubMed:8760805)Curated
    Sequence conflicti269 – 2691A → R in AAB06194. (PubMed:8618853)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti106 – 1061V → I.1 Publication
    Corresponds to variant rs9471966 [ dbSNP | Ensembl ].
    VAR_038957
    Natural varianti183 – 1831A → T.
    Corresponds to variant rs36111725 [ dbSNP | Ensembl ].
    VAR_038958

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei20 – 126107Missing in isoform 2. 1 PublicationVSP_031445Add
    BLAST
    Alternative sequencei21 – 5939VGGTP…PGLDS → PVSFPSSPEAATTG in isoform 3. 1 PublicationVSP_031446Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U36759 mRNA. Translation: AAB06194.1.
    AF084941 Genomic DNA. Translation: AAC83346.1.
    AF101436 mRNA. Translation: AAF21890.1.
    AF165312 mRNA. Translation: AAF89556.1.
    AL035587 Genomic DNA. Translation: CAI21484.2.
    BC069336 mRNA. Translation: AAH69336.1.
    BC100771 mRNA. Translation: AAI00772.1.
    BC100772 mRNA. Translation: AAI00773.1.
    BC100773 mRNA. Translation: AAI00774.1.
    BC100774 mRNA. Translation: AAI00775.1.
    BC153829 mRNA. Translation: AAI53830.1.
    U38996 mRNA. Translation: AAB18373.1.
    CCDSiCCDS4874.1. [Q6ISU1-1]
    CCDS59019.1. [Q6ISU1-3]
    CCDS59020.1. [Q6ISU1-2]
    RefSeqiNP_001230097.1. NM_001243168.1.
    NP_001230098.1. NM_001243169.1. [Q6ISU1-3]
    NP_001230099.1. NM_001243170.1. [Q6ISU1-2]
    NP_612153.2. NM_138296.2. [Q6ISU1-1]
    UniGeneiHs.169002.

    Genome annotation databases

    EnsembliENST00000304672; ENSP00000304447; ENSG00000171611. [Q6ISU1-1]
    ENST00000441198; ENSP00000409550; ENSG00000171611. [Q6ISU1-3]
    ENST00000446507; ENSP00000392288; ENSG00000171611. [Q6ISU1-2]
    GeneIDi171558.
    KEGGihsa:171558.
    UCSCiuc003osx.3. human. [Q6ISU1-1]
    uc010jxy.3. human. [Q6ISU1-3]
    uc010jxz.3. human. [Q6ISU1-2]

    Polymorphism databases

    DMDMi74736631.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U36759 mRNA. Translation: AAB06194.1 .
    AF084941 Genomic DNA. Translation: AAC83346.1 .
    AF101436 mRNA. Translation: AAF21890.1 .
    AF165312 mRNA. Translation: AAF89556.1 .
    AL035587 Genomic DNA. Translation: CAI21484.2 .
    BC069336 mRNA. Translation: AAH69336.1 .
    BC100771 mRNA. Translation: AAI00772.1 .
    BC100772 mRNA. Translation: AAI00773.1 .
    BC100773 mRNA. Translation: AAI00774.1 .
    BC100774 mRNA. Translation: AAI00775.1 .
    BC153829 mRNA. Translation: AAI53830.1 .
    U38996 mRNA. Translation: AAB18373.1 .
    CCDSi CCDS4874.1. [Q6ISU1-1 ]
    CCDS59019.1. [Q6ISU1-3 ]
    CCDS59020.1. [Q6ISU1-2 ]
    RefSeqi NP_001230097.1. NM_001243168.1.
    NP_001230098.1. NM_001243169.1. [Q6ISU1-3 ]
    NP_001230099.1. NM_001243170.1. [Q6ISU1-2 ]
    NP_612153.2. NM_138296.2. [Q6ISU1-1 ]
    UniGenei Hs.169002.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    3OF6 X-ray 2.80 D/E/F 17-135 [» ]
    ProteinModelPortali Q6ISU1.
    SMRi Q6ISU1. Positions 23-126.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 128144. 4 interactions.
    IntActi Q6ISU1. 1 interaction.
    MINTi MINT-7219046.
    STRINGi 9606.ENSP00000304447.

    Polymorphism databases

    DMDMi 74736631.

    Proteomic databases

    PaxDbi Q6ISU1.
    PRIDEi Q6ISU1.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000304672 ; ENSP00000304447 ; ENSG00000171611 . [Q6ISU1-1 ]
    ENST00000441198 ; ENSP00000409550 ; ENSG00000171611 . [Q6ISU1-3 ]
    ENST00000446507 ; ENSP00000392288 ; ENSG00000171611 . [Q6ISU1-2 ]
    GeneIDi 171558.
    KEGGi hsa:171558.
    UCSCi uc003osx.3. human. [Q6ISU1-1 ]
    uc010jxy.3. human. [Q6ISU1-3 ]
    uc010jxz.3. human. [Q6ISU1-2 ]

    Organism-specific databases

    CTDi 171558.
    GeneCardsi GC06P042883.
    HGNCi HGNC:21290. PTCRA.
    MIMi 606817. gene.
    neXtProti NX_Q6ISU1.
    PharmGKBi PA134993184.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG25752.
    HOGENOMi HOG000115761.
    HOVERGENi HBG061856.
    InParanoidi Q6ISU1.
    KOi K06056.
    OMAi SPVWEEG.
    OrthoDBi EOG75B864.
    PhylomeDBi Q6ISU1.
    TreeFami TF337868.

    Miscellaneous databases

    EvolutionaryTracei Q6ISU1.
    GenomeRNAii 171558.
    NextBioi 89289.
    PROi Q6ISU1.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q6ISU1.
    CleanExi HS_PTCRA.
    Genevestigatori Q6ISU1.

    Family and domain databases

    InterProi IPR027834. PTCRA.
    [Graphical view ]
    Pfami PF15028. PTCRA. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and comparative analysis of the human pre-T-cell receptor alpha-chain gene."
      Del Porto P., Bruno L., Mattei M.-G., von Boehmer H., Saint-Ruf C.
      Proc. Natl. Acad. Sci. U.S.A. 92:12105-12109(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
      Tissue: Thymus.
    2. "Genomic structure of the human pre-T cell receptor alpha chain and expression of two mRNA isoforms."
      Saint-Ruf C., Lechner O., Feinberg J., von Boehmer H.
      Eur. J. Immunol. 28:3824-3831(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1 AND 2).
      Tissue: Lymphoblast.
    3. "Alternatively spliced human pre-T alpha chain, mRNA."
      Ramiro A.R., Toribio M.L.
      Submitted (OCT-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3).
    4. "The DNA sequence and analysis of human chromosome 6."
      Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
      , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
      Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ILE-106.
    6. "Regulation of pre-T cell receptor (pT alpha-TCR beta) gene expression during human thymic development."
      Ramiro A.R., Trigueros C., Marquez C., San Millan J.L., Toribio M.L.
      J. Exp. Med. 184:519-530(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 13-281 (ISOFORM 1), SUBUNIT, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
      Tissue: Thymus.
    7. "Ubiquitin-dependent intramembrane rhomboid protease promotes ERAD of membrane proteins."
      Fleig L., Bergbold N., Sahasrabudhe P., Geiger B., Kaltak L., Lemberg M.K.
      Mol. Cell 47:558-569(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH RHBDD1.
    8. Cited for: X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS) OF 17-135, SUBUNIT, DISULFIDE BOND, GLYCOSYLATION AT ASN-67.

    Entry informationi

    Entry nameiPTCRA_HUMAN
    AccessioniPrimary (citable) accession number: Q6ISU1
    Secondary accession number(s): Q5TFZ7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 26, 2008
    Last sequence update: July 5, 2004
    Last modified: October 1, 2014
    This is version 86 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 6
      Human chromosome 6: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references

    External Data

    Dasty 3