Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Pre T-cell antigen receptor alpha

Gene

PTCRA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

The pre-T-cell receptor complex (composed of PTCRA, TCRB and the CD3 complex) regulates early T-cell development.By similarity

Keywords - Molecular functioni

Receptor

Enzyme and pathway databases

SIGNORiQ6ISU1.

Names & Taxonomyi

Protein namesi
Recommended name:
Pre T-cell antigen receptor alpha
Short name:
pT-alpha
Short name:
pTa
Alternative name(s):
pT-alpha-TCR
Gene namesi
Name:PTCRA
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:21290. PTCRA.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini24 – 146ExtracellularSequence analysisAdd BLAST123
Transmembranei147 – 167HelicalSequence analysisAdd BLAST21
Topological domaini168 – 281CytoplasmicSequence analysisAdd BLAST114

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi171558.
OpenTargetsiENSG00000171611.
PharmGKBiPA134993184.

Polymorphism and mutation databases

BioMutaiPTCRA.
DMDMi74736631.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 23Sequence analysisAdd BLAST23
ChainiPRO_000031910824 – 281Pre T-cell antigen receptor alphaAdd BLAST258

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi47 ↔ 1071 Publication
Glycosylationi67N-linked (GlcNAc...)1 Publication1
Disulfide bondi135Interchain (with TCRB)1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ6ISU1.
PeptideAtlasiQ6ISU1.
PRIDEiQ6ISU1.

PTM databases

iPTMnetiQ6ISU1.
PhosphoSitePlusiQ6ISU1.

Expressioni

Tissue specificityi

Expressed in immature but not mature T-cells. Also found in CD34+ cells from peripheral blood, CD34+ precursors from umbilical cord blood and adult bone marrow.2 Publications

Developmental stagei

Expressed in fetal life in CD34+ progenitors present in the liver at 18 weeks of gestation but is absent in CD34+ precursors from fetal bone marrow at any developmental stage up to 22 weeks.1 Publication

Gene expression databases

BgeeiENSG00000171611.
CleanExiHS_PTCRA.
ExpressionAtlasiQ6ISU1. baseline and differential.
GenevisibleiQ6ISU1. HS.

Organism-specific databases

HPAiCAB033120.

Interactioni

Subunit structurei

Heterodimer with TCRB; disulfide linked. This heterodimer assembles with CD3 proteins into a signaling-competent pre-T-cell receptor complex. Interacts with RHBDD1.3 Publications

Protein-protein interaction databases

BioGridi128144. 9 interactors.
IntActiQ6ISU1. 1 interactor.
MINTiMINT-7219046.
STRINGi9606.ENSP00000304447.

Structurei

Secondary structure

1281
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi33 – 52Combined sources20
Beta strandi62 – 64Combined sources3
Beta strandi66 – 68Combined sources3
Beta strandi79 – 81Combined sources3
Turni82 – 84Combined sources3
Beta strandi85 – 95Combined sources11
Helixi96 – 100Combined sources5
Beta strandi104 – 109Combined sources6

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3OF6X-ray2.80D/E/F17-135[»]
ProteinModelPortaliQ6ISU1.
SMRiQ6ISU1.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ6ISU1.

Family & Domainsi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IXJS. Eukaryota.
ENOG41114MB. LUCA.
GeneTreeiENSGT00390000007712.
HOGENOMiHOG000115761.
HOVERGENiHBG061856.
InParanoidiQ6ISU1.
KOiK06056.
PhylomeDBiQ6ISU1.
TreeFamiTF337868.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR027834. PTCRA.
[Graphical view]
PfamiPF15028. PTCRA. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6ISU1-1) [UniParc]FASTAAdd to basket
Also known as: pTalpha-1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGTWLLLLL ALGCPALPTG VGGTPFPSLA PPIMLLVDGK QQMVVVCLVL
60 70 80 90 100
DVAPPGLDSP IWFSAGNGSA LDAFTYGPSP ATDGTWTNLA HLSLPSEELA
110 120 130 140 150
SWEPLVCHTG PGAEGHSRST QPMHLSGEAS TARTCPQEPL RGTPGGALWL
160 170 180 190 200
GVLRLLLFKL LLFDLLLTCS CLCDPAGPLP SPATTTRLRA LGSHRLHPAT
210 220 230 240 250
ETGGREATSS PRPQPRDRRW GDTPPGRKPG SPVWGEGSYL SSYPTCPAQA
260 270 280
WCSRSALRAP SSSLGAFFAG DLPPPLQAGA A
Length:281
Mass (Da):29,266
Last modified:July 5, 2004 - v1
Checksum:iA49B86A151619B9F
GO
Isoform 2 (identifier: Q6ISU1-2) [UniParc]FASTAAdd to basket
Also known as: pTalpha-2

The sequence of this isoform differs from the canonical sequence as follows:
     20-126: Missing.

Show »
Length:174
Mass (Da):18,222
Checksum:iA7EAEAD3884692A3
GO
Isoform 3 (identifier: Q6ISU1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     21-59: VGGTPFPSLAPPIMLLVDGKQQMVVVCLVLDVAPPGLDS → PVSFPSSPEAATTG

Show »
Length:256
Mass (Da):26,638
Checksum:i815805A8311B0B3B
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti256A → R in AAB06194 (PubMed:8618853).Curated1
Sequence conflicti256A → R in AAC83346 (PubMed:9842925).Curated1
Sequence conflicti256A → R in AAF89556 (Ref. 3) Curated1
Sequence conflicti256A → R in AAB18373 (PubMed:8760805).Curated1
Sequence conflicti269A → R in AAB06194 (PubMed:8618853).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_038957106V → I.1 PublicationCorresponds to variant rs9471966dbSNPEnsembl.1
Natural variantiVAR_038958183A → T.Corresponds to variant rs36111725dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_03144520 – 126Missing in isoform 2. 1 PublicationAdd BLAST107
Alternative sequenceiVSP_03144621 – 59VGGTP…PGLDS → PVSFPSSPEAATTG in isoform 3. 1 PublicationAdd BLAST39

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U36759 mRNA. Translation: AAB06194.1.
AF084941 Genomic DNA. Translation: AAC83346.1.
AF101436 mRNA. Translation: AAF21890.1.
AF165312 mRNA. Translation: AAF89556.1.
AL035587 Genomic DNA. Translation: CAI21484.2.
BC069336 mRNA. Translation: AAH69336.1.
BC100771 mRNA. Translation: AAI00772.1.
BC100772 mRNA. Translation: AAI00773.1.
BC100773 mRNA. Translation: AAI00774.1.
BC100774 mRNA. Translation: AAI00775.1.
BC153829 mRNA. Translation: AAI53830.1.
U38996 mRNA. Translation: AAB18373.1.
CCDSiCCDS4874.1. [Q6ISU1-1]
CCDS59019.1. [Q6ISU1-3]
CCDS59020.1. [Q6ISU1-2]
RefSeqiNP_001230097.1. NM_001243168.1.
NP_001230098.1. NM_001243169.1. [Q6ISU1-3]
NP_001230099.1. NM_001243170.1. [Q6ISU1-2]
NP_612153.2. NM_138296.2. [Q6ISU1-1]
UniGeneiHs.169002.

Genome annotation databases

EnsembliENST00000304672; ENSP00000304447; ENSG00000171611. [Q6ISU1-1]
ENST00000441198; ENSP00000409550; ENSG00000171611. [Q6ISU1-3]
ENST00000446507; ENSP00000392288; ENSG00000171611. [Q6ISU1-2]
GeneIDi171558.
KEGGihsa:171558.
UCSCiuc003osx.4. human. [Q6ISU1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U36759 mRNA. Translation: AAB06194.1.
AF084941 Genomic DNA. Translation: AAC83346.1.
AF101436 mRNA. Translation: AAF21890.1.
AF165312 mRNA. Translation: AAF89556.1.
AL035587 Genomic DNA. Translation: CAI21484.2.
BC069336 mRNA. Translation: AAH69336.1.
BC100771 mRNA. Translation: AAI00772.1.
BC100772 mRNA. Translation: AAI00773.1.
BC100773 mRNA. Translation: AAI00774.1.
BC100774 mRNA. Translation: AAI00775.1.
BC153829 mRNA. Translation: AAI53830.1.
U38996 mRNA. Translation: AAB18373.1.
CCDSiCCDS4874.1. [Q6ISU1-1]
CCDS59019.1. [Q6ISU1-3]
CCDS59020.1. [Q6ISU1-2]
RefSeqiNP_001230097.1. NM_001243168.1.
NP_001230098.1. NM_001243169.1. [Q6ISU1-3]
NP_001230099.1. NM_001243170.1. [Q6ISU1-2]
NP_612153.2. NM_138296.2. [Q6ISU1-1]
UniGeneiHs.169002.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3OF6X-ray2.80D/E/F17-135[»]
ProteinModelPortaliQ6ISU1.
SMRiQ6ISU1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128144. 9 interactors.
IntActiQ6ISU1. 1 interactor.
MINTiMINT-7219046.
STRINGi9606.ENSP00000304447.

PTM databases

iPTMnetiQ6ISU1.
PhosphoSitePlusiQ6ISU1.

Polymorphism and mutation databases

BioMutaiPTCRA.
DMDMi74736631.

Proteomic databases

PaxDbiQ6ISU1.
PeptideAtlasiQ6ISU1.
PRIDEiQ6ISU1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000304672; ENSP00000304447; ENSG00000171611. [Q6ISU1-1]
ENST00000441198; ENSP00000409550; ENSG00000171611. [Q6ISU1-3]
ENST00000446507; ENSP00000392288; ENSG00000171611. [Q6ISU1-2]
GeneIDi171558.
KEGGihsa:171558.
UCSCiuc003osx.4. human. [Q6ISU1-1]

Organism-specific databases

CTDi171558.
DisGeNETi171558.
GeneCardsiPTCRA.
HGNCiHGNC:21290. PTCRA.
HPAiCAB033120.
MIMi606817. gene.
neXtProtiNX_Q6ISU1.
OpenTargetsiENSG00000171611.
PharmGKBiPA134993184.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IXJS. Eukaryota.
ENOG41114MB. LUCA.
GeneTreeiENSGT00390000007712.
HOGENOMiHOG000115761.
HOVERGENiHBG061856.
InParanoidiQ6ISU1.
KOiK06056.
PhylomeDBiQ6ISU1.
TreeFamiTF337868.

Enzyme and pathway databases

SIGNORiQ6ISU1.

Miscellaneous databases

EvolutionaryTraceiQ6ISU1.
GenomeRNAii171558.
PROiQ6ISU1.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000171611.
CleanExiHS_PTCRA.
ExpressionAtlasiQ6ISU1. baseline and differential.
GenevisibleiQ6ISU1. HS.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR027834. PTCRA.
[Graphical view]
PfamiPF15028. PTCRA. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiPTCRA_HUMAN
AccessioniPrimary (citable) accession number: Q6ISU1
Secondary accession number(s): Q5TFZ7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: July 5, 2004
Last modified: November 30, 2016
This is version 103 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.