Q6IQ55 (TTBK2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 100.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Tau-tubulin kinase 2 EC=2.7.11.1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1244 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Serine/threonine kinase that acts as a key regulator of ciliogenesis: controls the initiation of ciliogenesis by binding to the distal end of the basal body and promoting the removal of CCP110, which caps the mother centriole, leading to the recruitment of IFT proteins, which build the ciliary axoneme. Has some substrate preference for proteins that are already phosphorylated on a Tyr residue at the +2 position relative to the phosphorylation site. Able to phosphorylate tau on serines in vitro. Ref.6 Ref.9 |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. Ref.6 |
| Subunit structure | Interacts with CEP164. Ref.8 |
| Subcellular location | Cell projection › cilium By similarity. Cytoplasm › cytoskeleton › cilium basal body By similarity. Cytoplasm › cytoskeleton › centrosome › centriole. Cytoplasm › cytosol. Nucleus. Note: Localizes to the transition zone in primary cilia in response to cell cycle signals that promote ciliogenesis By similarity. May also be present in cytosol and, at lower level in the nucleus. Ref.6 Ref.9 |
| Involvement in disease | Spinocerebellar ataxia 11 (SCA11) [MIM:604432]: Spinocerebellar ataxia is a clinically and genetically heterogeneous group of cerebellar disorders. Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to degeneration of the cerebellum with variable involvement of the brainstem and spinal cord. SCA11 is an autosomal dominant cerebellar ataxia (ADCA).It is a relatively benign, late-onset, slowly progressive neurologic disorder. |
| Sequence similarities | Belongs to the protein kinase superfamily. CK1 Ser/Thr protein kinase family. Contains 1 protein kinase domain. |
| Biophysicochemical properties | Kinetic parameters: KM=18 µM for RRKDLHDDEEDEAMSIYpA peptide Ref.6 KM=141 µM for RRKDLHDDEEDEAMSIYA peptide Vmax=76 µmol/min/mg enzyme with RRKDLHDDEEDEAMSIYpA peptide as substrate Vmax=66 µmol/min/mg enzyme with RRKDLHDDEEDEAMSIYA peptide as substrate |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CEP164 | Q9UPV0 | 4 | EBI-1050303,EBI-3937015 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6IQ55-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6IQ55-2) The sequence of this isoform differs from the canonical sequence as follows: 1-72: MSGGGEQLDILSVGILVKERWKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQVLKMEVAVLKKLQ → MES 1233-1244: QGKSKPASKLSR → PREE | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q6IQ55-3) The sequence of this isoform differs from the canonical sequence as follows: 470-478: CLEKMQKDT → WYKIVYFSF 479-1244: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1244 | 1244 | Tau-tubulin kinase 2 | PRO_0000234342 | |||||
Regions | |||||||||
| Domain | 21 – 284 | 264 | Protein kinase | ||||||
| Nucleotide binding | 27 – 35 | 9 | ATP By similarity | ||||||
| Compositional bias | 307 – 314 | 8 | Poly-Thr | ||||||
| Compositional bias | 1150 – 1203 | 54 | Ser-rich | ||||||
Sites | |||||||||
| Active site | 141 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 50 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 786 | 1 | Phosphoserine Ref.7 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 72 | 72 | MSGGG…LKKLQ → MES in isoform 2. | VSP_018272 | |||||
| Alternative sequence | 470 – 478 | 9 | CLEKMQKDT → WYKIVYFSF in isoform 3. | VSP_018273 | |||||
| Alternative sequence | 479 – 1244 | 766 | Missing in isoform 3. | VSP_018274 | |||||
| Alternative sequence | 1233 – 1244 | 12 | QGKSK…SKLSR → PREE in isoform 2. | VSP_018275 | |||||
| Natural variant | 8 | 1 | L → P. Ref.3 Ref.10 Ref.11 Corresponds to variant rs6493068 [ dbSNP | Ensembl ]. | VAR_041261 | |||||
| Natural variant | 120 | 1 | R → Q. Ref.10 Corresponds to variant rs35328266 [ dbSNP | Ensembl ]. | VAR_041262 | |||||
| Natural variant | 313 | 1 | T → A. Ref.10 Corresponds to variant rs56017612 [ dbSNP | Ensembl ]. | VAR_041263 | |||||
| Natural variant | 440 | 1 | V → M. Ref.10 Corresponds to variant rs56311523 [ dbSNP | Ensembl ]. | VAR_041264 | |||||
| Natural variant | 500 | 1 | R → P. Ref.10 Corresponds to variant rs56039839 [ dbSNP | Ensembl ]. | VAR_041265 | |||||
| Natural variant | 635 | 1 | D → G in a lung small cell carcinoma sample; somatic mutation. Ref.10 | VAR_041266 | |||||
| Natural variant | 842 | 1 | E → G Found in a patient with SCA11; unknown pathological significance. Ref.11 Corresponds to variant rs202004988 [ dbSNP | Ensembl ]. | VAR_069052 | |||||
| Natural variant | 1062 | 1 | T → I. Ref.10 Corresponds to variant rs55833708 [ dbSNP | Ensembl ]. | VAR_041267 | |||||
| Natural variant | 1084 | 1 | T → M. Ref.10 Corresponds to variant rs34348991 [ dbSNP | Ensembl ]. | VAR_041268 | |||||
| Natural variant | 1097 | 1 | V → A. Ref.10 Corresponds to variant rs55796513 [ dbSNP | Ensembl ]. | VAR_041269 | |||||
| Natural variant | 1110 | 1 | R → H Found in a patient with SCA11; unknown pathological significance. Ref.11 | VAR_069053 | |||||
| Natural variant | 1122 | 1 | P → R. Ref.10 Corresponds to variant rs56142516 [ dbSNP | Ensembl ]. | VAR_041270 | |||||
| Natural variant | 1241 | 1 | K → T. Ref.10 Corresponds to variant rs36104367 [ dbSNP | Ensembl ]. | VAR_041271 | |||||
Experimental info | |||||||||
| Mutagenesis | 50 | 1 | K → E or A: Leads to inactivation/destabilization of the protein. Ref.6 | ||||||
| Mutagenesis | 143 | 1 | K → E or A: Leads to inactivation/destabilization of the protein. Ref.6 | ||||||
| Mutagenesis | 163 | 1 | D → A: Abolishes serine/threonine-protein kinase activity. Ref.6 | ||||||
| Mutagenesis | 181 | 1 | R → E or A: Impaired serine/threonine-protein kinase activity. Ref.6 | ||||||
| Mutagenesis | 184 | 1 | A → E or G: Impaired serine/threonine-protein kinase activity. Ref.6 | ||||||
| Sequence conflict | 309 | 1 | T → I in BAD18523. Ref.1 | ||||||
| Sequence conflict | 456 | 1 | T → A in BAD18523. Ref.1 | ||||||
| Sequence conflict | 557 | 1 | K → N in BAD18523. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Cerebellum. |
| [2] | "Analysis of the DNA sequence and duplication history of human chromosome 15." Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A. Nusbaum C.Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANT PRO-8. Tissue: Testis. |
| [4] | "Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:355-364(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 600-1244 (ISOFORM 1). Tissue: Brain. |
| [5] | "Mutations in TTBK2, encoding a kinase implicated in tau phosphorylation, segregate with spinocerebellar ataxia type 11." Houlden H., Johnson J., Gardner-Thorpe C., Lashley T., Hernandez D., Worth P., Singleton A.B., Hilton D.A., Holton J., Revesz T., Davis M.B., Giunti P., Wood N.W. Nat. Genet. 39:1434-1436(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN SCA11. |
| [6] | "TTBK2 kinase substrate specificity and the impact of spinocerebellar-ataxia-causing mutations on expression, activity, localization and development." Bouskila M., Esoof N., Gay L., Fang E.H., Deak M., Begley M.J., Cantley L.C., Prescott A., Storey K.G., Alessi D.R. Biochem. J. 437:157-167(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, SUBCELLULAR LOCATION, MUTAGENESIS OF LYS-50; LYS-143; ASP-163; ARG-181 AND ALA-184. |
| [7] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-786, MASS SPECTROMETRY. |
| [8] | "Exome capture reveals ZNF423 and CEP164 mutations, linking renal ciliopathies to DNA damage response signaling." Chaki M., Airik R., Ghosh A.K., Giles R.H., Chen R., Slaats G.G., Wang H., Hurd T.W., Zhou W., Cluckey A., Gee H.Y., Ramaswami G., Hong C.J., Hamilton B.A., Cervenka I., Ganji R.S., Bryja V., Arts H.H. Hildebrandt F.Cell 150:533-548(2012) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CEP164. |
| [9] | "The spinocerebellar ataxia-associated gene tau tubulin kinase 2 controls the initiation of ciliogenesis." Goetz S.C., Liem K.F. Jr., Anderson K.V. Cell 151:847-858(2012) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| [10] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] PRO-8; GLN-120; ALA-313; MET-440; PRO-500; GLY-635; ILE-1062; MET-1084; ALA-1097; ARG-1122 AND THR-1241. |
| [11] | "Missense exchanges in the TTBK2 gene mutated in SCA11." Edener U., Kurth I., Meiner A., Hoffmann F., Hubner C.A., Bernard V., Gillessen-Kaesbach G., Zuhlke C. J. Neurol. 256:1856-1859(2009) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS PRO-8; GLY-842 AND HIS-1110. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK131372 mRNA. Translation: BAD18523.1. AC068727 Genomic DNA. No translation available. AC090510 Genomic DNA. No translation available. BC041876 mRNA. Translation: AAH41876.1. BC071556 mRNA. Translation: AAH71556.1. AB020654 mRNA. Translation: BAA74870.1. |
| IPI | IPI00217145. IPI00743279. IPI00743694. |
| RefSeq | NP_775771.3. NM_173500.3. |
| UniGene | Hs.646511. Hs.727864. |
3D structure databases | |
| ProteinModelPortal | Q6IQ55. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q6IQ55. 3 interactions. |
| STRING | 9606.ENSP00000267890. |
PTM databases | |
| PhosphoSite | Q6IQ55. |
Polymorphism databases | |
| DMDM | 116242833. |
Proteomic databases | |
| PaxDb | Q6IQ55. |
| PRIDE | Q6IQ55. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000267890; ENSP00000267890; ENSG00000128881. ENST00000567840; ENSP00000455734; ENSG00000128881. |
| GeneID | 146057. |
| KEGG | hsa:146057. |
| UCSC | uc001zqo.2. human. uc001zqp.3. human. |
Organism-specific databases | |
| CTD | 146057. |
| GeneCards | GC15M043030. |
| H-InvDB | HIX0012177. |
| HGNC | HGNC:19141. TTBK2. |
| HPA | HPA018113. |
| MIM | 604432. phenotype. 611695. gene. |
| neXtProt | NX_Q6IQ55. |
| Orphanet | 98767. Spinocerebellar ataxia type 11. |
| PharmGKB | PA134913925. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0515. |
| HOGENOM | HOG000232043. |
| HOVERGEN | HBG061812. |
| KO | K08815. |
Gene expression databases | |
| ArrayExpress | Q6IQ55. |
| Bgee | Q6IQ55. |
| CleanEx | HS_TTBK2. |
| Genevestigator | Q6IQ55. |
| GermOnline | ENSG00000128881. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. [Graphical view] |
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] |
| SUPFAM | SSF56112. Kinase_like. 1 hit. |
| PROSITE | PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 146057. |
| NextBio | 85251. |
| SOURCE | Search... |
Entry information
| Entry name | TTBK2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6IQ55 Secondary accession number(s): O94932, Q6ZN52, Q8IVV1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 15 Human chromosome 15: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
