Reviewed,
UniProtKB/Swiss-Prot Q6IQ55 (TTBK2_HUMAN)
Last modified
December 16, 2008.
Version 54.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Tau-tubulin kinase 2 EC=2.7.11.1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1244 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Serine/threonine kinase which is able to phosphorylate tau on serines By similarity. |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Involvement in disease | Defects in TTBK2 are the cause of spinocerebellar ataxia type 11 (SCA11) [MIM:604432]. Spinocerebellar ataxia is a clinically and genetically heterogeneous group of cerebellar disorders. Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to degeneration of the cerebellum with variable involvement of the brainstem and spinal cord. SCA11 is an autosomal dominant cerebellar ataxia (ADCA). It is a relatively benign, late-onset, slowly progressive neurologic disorder. Ref.4 |
| Sequence similarities | Belongs to the protein kinase superfamily. CK1 Ser/Thr protein kinase family. Contains 1 protein kinase domain. |
Ontologies
Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Neurodegeneration Spinocerebellar ataxia |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Kinase Serine/threonine-protein kinase Transferase |
Gene Ontology (GO) | |
| Biological process | cell death Inferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | ATP binding Inferred from electronic annotation. Source: InterPro protein serine/threonine kinase activityInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6IQ55-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6IQ55-2) The sequence of this isoform differs from the canonical sequence as follows: 1-72: MSGGGEQLDILSVGILVKERWKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQVLKMEVAVLKKLQ → MES 1233-1244: QGKSKPASKLSR → PREE | ||||||
| Notes: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q6IQ55-3) The sequence of this isoform differs from the canonical sequence as follows: 470-478: CLEKMQKDT → WYKIVYFSF 479-1244: Missing. | ||||||
| Notes: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1244 | 1244 | Tau-tubulin kinase 2 | PRO_0000234342 | |||||
Regions | |||||||||
| Domain | 21 – 284 | 264 | Protein kinase | ||||||
| Nucleotide binding | 27 – 35 | 9 | ATP By similarity | ||||||
| Compositional bias | 307 – 314 | 8 | Poly-Thr | ||||||
| Compositional bias | 1150 – 1203 | 54 | Ser-rich | ||||||
Sites | |||||||||
| Active site | 141 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 50 | 1 | ATP By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 72 | 72 | MSGGG…LKKLQ → MES in isoform 2. | VSP_018272 | |||||
| Alternative sequence | 470 – 478 | 9 | CLEKMQKDT → WYKIVYFSF in isoform 3. | VSP_018273 | |||||
| Alternative sequence | 479 – 1244 | 766 | Missing in isoform 3. | VSP_018274 | |||||
| Alternative sequence | 1233 – 1244 | 12 | QGKSK…SKLSR → PREE in isoform 2. | VSP_018275 | |||||
| Natural variant | 8 | 1 | L → P: dbSNP rs6493068. | VAR_041261 | |||||
| Natural variant | 120 | 1 | R → Q: dbSNP rs35328266. | VAR_041262 | |||||
| Natural variant | 313 | 1 | T → A Ref.5 | VAR_041263 | |||||
| Natural variant | 440 | 1 | V → M Ref.5 | VAR_041264 | |||||
| Natural variant | 500 | 1 | R → P Ref.5 | VAR_041265 | |||||
| Natural variant | 635 | 1 | D → G in a lung small cell carcinoma sample; somatic mutation. Ref.5 | VAR_041266 | |||||
| Natural variant | 1062 | 1 | T → I Ref.5 | VAR_041267 | |||||
| Natural variant | 1084 | 1 | T → M: dbSNP rs34348991. | VAR_041268 | |||||
| Natural variant | 1097 | 1 | V → A Ref.5 | VAR_041269 | |||||
| Natural variant | 1122 | 1 | P → R Ref.5 | VAR_041270 | |||||
| Natural variant | 1241 | 1 | K → T: dbSNP rs36104367. | VAR_041271 | |||||
Experimental info | |||||||||
| Sequence conflict | 309 | 1 | T → I in BAD18523. Ref.1 | ||||||
| Sequence conflict | 456 | 1 | T → A in BAD18523. Ref.1 | ||||||
| Sequence conflict | 557 | 1 | K → N in BAD18523. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Cerebellum. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANT PRO-8. Tissue: Testis. |
| [3] | "Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:355-364(1998) [PubMed: 10048485] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 600-1244 (ISOFORM 1). Tissue: Brain. |
| [4] | "Mutations in TTBK2, encoding a kinase implicated in tau phosphorylation, segregate with spinocerebellar ataxia type 11." Houlden H., Johnson J., Gardner-Thorpe C., Lashley T., Hernandez D., Worth P., Singleton A.B., Hilton D.A., Holton J., Revesz T., Davis M.B., Giunti P., Wood N.W. Nat. Genet. 39:1434-1436(2007) [PubMed: 18037885] [Abstract] Cited for: INVOLVEMENT IN SCA11. |
| [5] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed: 17344846] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] PRO-8; GLN-120; ALA-313; MET-440; PRO-500; GLY-635; ILE-1062; MET-1084; ALA-1097; ARG-1122 AND THR-1241. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AK131372 mRNA. Translation: BAD18523.1. BC041876 mRNA. Translation: AAH41876.1. BC071556 mRNA. Translation: AAH71556.1. AB020654 mRNA. Translation: BAA74870.1. | |
| RefSeq | NP_775771.3. |
| UniGene | Hs.659846 Hs.695195 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1CKI based on UniProtKB Q06486. |
| ModBase | Search... |
Proteomic databases | |
| PRIDE | Q6IQ55. |
Genome annotation databases | |
| Ensembl | ENSG00000128881. Homo sapiens. [Contig view] |
| GeneID | 146057. |
| KEGG | hsa:146057. |
Organism-specific databases | |
| GeneCards | GC15M040825. |
| HGNC | HGNC:19141. TTBK2. |
| HPA | HPA018113. |
| MIM | 604432. phenotype. 611695. gene. |
| Orphanet | 98767. SCA11. |
| PharmGKB | PA134913925. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | Q6IQ55. |
Gene expression databases | |
| ArrayExpress | Q6IQ55. |
| CleanEx | HS_TTBK2. |
| GermOnline | ENSG00000128881. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000719. Prot_kinase_core. IPR017441. Protein_kinase_ATP_bd_CS. IPR017442. Se/Thr_pkinase-rel. IPR008271. Ser_thr_pkin_AS. [Graphical view] |
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] |
| ProDom | PD000001. Prot_kinase. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| PROSITE | PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. False negative. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 85251. |
| SOURCE | Search... |
Entry information
| Entry name | TTBK2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6IQ55 Secondary accession number(s): O94932, Q6ZN52, Q8IVV1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 15 Human chromosome 15: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| SIMILARITY comments Index of protein domains and families |

Clusters with


