Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Uncharacterized protein C11orf71

Gene

C11orf71

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 1 out of 5-Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Uncharacterized protein C11orf71
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:25937. C11orf71.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA144596490.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 123123Uncharacterized protein C11orf71PRO_0000274325Add
BLAST

Proteomic databases

PaxDbiQ6IPW1.
PRIDEiQ6IPW1.

PTM databases

iPTMnetiQ6IPW1.
PhosphoSiteiQ6IPW1.

Expressioni

Gene expression databases

BgeeiQ6IPW1.
CleanExiHS_C11orf71.
GenevisibleiQ6IPW1. HS.

Interactioni

Protein-protein interaction databases

BioGridi119990. 3 interactions.
IntActiQ6IPW1. 3 interactions.
STRINGi9606.ENSP00000325508.

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410J0JN. Eukaryota.
ENOG4111CNR. LUCA.
GeneTreeiENSGT00390000007962.
HOGENOMiHOG000035132.
HOVERGENiHBG081224.
InParanoidiQ6IPW1.
OMAiQARFSPY.
OrthoDBiEOG74J9BN.
PhylomeDBiQ6IPW1.
TreeFamiTF337033.

Family and domain databases

InterProiIPR031487. DUF4687.
[Graphical view]
PfamiPF15747. DUF4687. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6IPW1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALNNVSLSS GDQRSRVAYR SSHGDLRPRA SALAMVSGDG FLVSRPEAIH
60 70 80 90 100
LGPRQAVRPS VRAESRRVDG GGRSPREPDG RGRSRQARFS PYPIPAVEPD
110 120
LLRSVLQQRL IALGGVIAAR ISV
Length:123
Mass (Da):13,249
Last modified:February 6, 2007 - v2
Checksum:i4B076F3B26670EFC
GO
Isoform 2 (identifier: Q6IPW1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     115-123: GVIAARISV → VTTWTLKLSESATPDLRWCSTCSHSNIFEILVI

Note: No experimental confirmation available.
Show »
Length:147
Mass (Da):16,116
Checksum:i59E33344047F43DF
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti30 – 301A → V in CAG33503 (Ref. 1) Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei115 – 1239GVIAARISV → VTTWTLKLSESATPDLRWCS TCSHSNIFEILVI in isoform 2. 1 PublicationVSP_022711

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
CR457222 mRNA. Translation: CAG33503.1.
AK000017 mRNA. Translation: BAA90886.1.
BC009041 mRNA. Translation: AAH09041.1.
BC071695 mRNA. Translation: AAH71695.1.
CCDSiCCDS76479.1. [Q6IPW1-1]
CCDS8369.2. [Q6IPW1-2]
RefSeqiNP_001258491.1. NM_001271562.1. [Q6IPW1-1]
NP_061894.2. NM_019021.3. [Q6IPW1-2]
UniGeneiHs.715083.

Genome annotation databases

EnsembliENST00000325636; ENSP00000325508; ENSG00000180425. [Q6IPW1-2]
ENST00000634180; ENSP00000488810; ENSG00000282682. [Q6IPW1-1]
GeneIDi54494.
KEGGihsa:54494.
UCSCiuc001pot.3. human. [Q6IPW1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
CR457222 mRNA. Translation: CAG33503.1.
AK000017 mRNA. Translation: BAA90886.1.
BC009041 mRNA. Translation: AAH09041.1.
BC071695 mRNA. Translation: AAH71695.1.
CCDSiCCDS76479.1. [Q6IPW1-1]
CCDS8369.2. [Q6IPW1-2]
RefSeqiNP_001258491.1. NM_001271562.1. [Q6IPW1-1]
NP_061894.2. NM_019021.3. [Q6IPW1-2]
UniGeneiHs.715083.

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119990. 3 interactions.
IntActiQ6IPW1. 3 interactions.
STRINGi9606.ENSP00000325508.

PTM databases

iPTMnetiQ6IPW1.
PhosphoSiteiQ6IPW1.

Proteomic databases

PaxDbiQ6IPW1.
PRIDEiQ6IPW1.

Protocols and materials databases

DNASUi54494.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000325636; ENSP00000325508; ENSG00000180425. [Q6IPW1-2]
ENST00000634180; ENSP00000488810; ENSG00000282682. [Q6IPW1-1]
GeneIDi54494.
KEGGihsa:54494.
UCSCiuc001pot.3. human. [Q6IPW1-1]

Organism-specific databases

CTDi54494.
GeneCardsiC11orf71.
HGNCiHGNC:25937. C11orf71.
neXtProtiNX_Q6IPW1.
PharmGKBiPA144596490.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J0JN. Eukaryota.
ENOG4111CNR. LUCA.
GeneTreeiENSGT00390000007962.
HOGENOMiHOG000035132.
HOVERGENiHBG081224.
InParanoidiQ6IPW1.
OMAiQARFSPY.
OrthoDBiEOG74J9BN.
PhylomeDBiQ6IPW1.
TreeFamiTF337033.

Miscellaneous databases

ChiTaRSiC11orf71. human.
GenomeRNAii54494.
PROiQ6IPW1.

Gene expression databases

BgeeiQ6IPW1.
CleanExiHS_C11orf71.
GenevisibleiQ6IPW1. HS.

Family and domain databases

InterProiIPR031487. DUF4687.
[Graphical view]
PfamiPF15747. DUF4687. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Adipose tissue.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Eye and Mammary gland.

Entry informationi

Entry nameiCK071_HUMAN
AccessioniPrimary (citable) accession number: Q6IPW1
Secondary accession number(s): Q6IAD3, Q9NXX1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: February 6, 2007
Last modified: June 8, 2016
This is version 83 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.