Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Uncharacterized protein C11orf71

Gene

C11orf71

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 1 out of 5-Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Uncharacterized protein C11orf71
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000180425.10.
HostDB:ENSG00000282682.1.
HGNCiHGNC:25937. C11orf71.

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000180425.
PharmGKBiPA144596490.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002743251 – 123Uncharacterized protein C11orf71Add BLAST123

Proteomic databases

PaxDbiQ6IPW1.
PeptideAtlasiQ6IPW1.
PRIDEiQ6IPW1.

PTM databases

iPTMnetiQ6IPW1.
PhosphoSitePlusiQ6IPW1.

Expressioni

Gene expression databases

BgeeiENSG00000180425.
CleanExiHS_C11orf71.
ExpressionAtlasiQ6IPW1. baseline and differential.
GenevisibleiQ6IPW1. HS.

Organism-specific databases

HPAiHPA063943.
HPA074787.

Interactioni

Protein-protein interaction databases

BioGridi119990. 3 interactors.
IntActiQ6IPW1. 3 interactors.
STRINGi9606.ENSP00000325508.

Structurei

3D structure databases

ProteinModelPortaliQ6IPW1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410J0JN. Eukaryota.
ENOG4111CNR. LUCA.
GeneTreeiENSGT00390000007962.
HOGENOMiHOG000035132.
HOVERGENiHBG081224.
InParanoidiQ6IPW1.
OMAiQARFSPY.
OrthoDBiEOG091G14WV.
PhylomeDBiQ6IPW1.
TreeFamiTF337033.

Family and domain databases

InterProiView protein in InterPro
IPR031487. DUF4687.
PfamiView protein in Pfam
PF15747. DUF4687. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6IPW1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALNNVSLSS GDQRSRVAYR SSHGDLRPRA SALAMVSGDG FLVSRPEAIH
60 70 80 90 100
LGPRQAVRPS VRAESRRVDG GGRSPREPDG RGRSRQARFS PYPIPAVEPD
110 120
LLRSVLQQRL IALGGVIAAR ISV
Length:123
Mass (Da):13,249
Last modified:February 6, 2007 - v2
Checksum:i4B076F3B26670EFC
GO
Isoform 2 (identifier: Q6IPW1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     115-123: GVIAARISV → VTTWTLKLSESATPDLRWCSTCSHSNIFEILVI

Note: No experimental confirmation available.
Show »
Length:147
Mass (Da):16,116
Checksum:i59E33344047F43DF
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti30A → V in CAG33503 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_022711115 – 123GVIAARISV → VTTWTLKLSESATPDLRWCS TCSHSNIFEILVI in isoform 2. 1 Publication9

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
CR457222 mRNA. Translation: CAG33503.1.
AK000017 mRNA. Translation: BAA90886.1.
BC009041 mRNA. Translation: AAH09041.1.
BC071695 mRNA. Translation: AAH71695.1.
CCDSiCCDS76479.1. [Q6IPW1-1]
CCDS8369.2. [Q6IPW1-2]
RefSeqiNP_001258491.1. NM_001271562.1. [Q6IPW1-1]
NP_061894.2. NM_019021.3. [Q6IPW1-2]
UniGeneiHs.715083.

Genome annotation databases

EnsembliENST00000325636; ENSP00000325508; ENSG00000180425. [Q6IPW1-2]
ENST00000623205; ENSP00000492536; ENSG00000180425. [Q6IPW1-1]
GeneIDi54494.
KEGGihsa:54494.
UCSCiuc001pot.3. human. [Q6IPW1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCK071_HUMAN
AccessioniPrimary (citable) accession number: Q6IPW1
Secondary accession number(s): Q6IAD3, Q9NXX1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: February 6, 2007
Last modified: September 27, 2017
This is version 92 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM